[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : sdpB
DDBJ      :sdpB         exporter of killing factor SpbC
Swiss-Prot:SDPB_BACSU   RecName: Full=Sporulation-delaying protein sdpB;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:323 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   140->203 PF05090 * VKG_Carbox 7e-05 34.9 %
:HMM:PFM   75->281 PF05090 * VKG_Carbox 1.7e-10 22.4 192/446  
:BLT:SWISS 1->323 SDPB_BACSU e-164 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15381.1 GT:GENE sdpB GT:PRODUCT exporter of killing factor SpbC GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3464762..3465733 GB:FROM 3464762 GB:TO 3465733 GB:DIRECTION + GB:GENE sdpB GB:PRODUCT exporter of killing factor SpbC GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15743949, 15849754, 16469701, 16850406, 17069462; Product type t : transporter GB:PROTEIN_ID CAB15381.1 GB:DB_XREF GOA:O34616 InterPro:IPR011020 SubtiList:BG14075 UniProtKB/Swiss-Prot:O34616 GB:GENE:GENE sdpB LENGTH 323 SQ:AASEQ MKILNSLEGYIDTYNPWKNTYALFRSLLGFSTLLVLLFNSTDILFSYSANNVTCENVYIPTAFCFAKEYSINFEIIRYLMIFILTLVVIGWRPRFTGLFHWYICYSIQTSALTIDGGEQIATVLSFLILPVTLLDSRRNHWNIKKNNNESFTKKTVLFYIMTIIKIQVFIIYLNAALERLKNKEWAEGTAIYYFFSDPVFGLPEYQLNLMNPLLESNFIVVITWLVTIFELFLAASIISNIRIKRIALVLGILFHIGIIFSIGIVSFGLIMISALIIYLHPVQQNITMNWCSPLFKYIYVKGKRNFKRIGGESVKFLTKLFHS GT:EXON 1|1-323:0| SW:ID SDPB_BACSU SW:DE RecName: Full=Sporulation-delaying protein sdpB; SW:GN Name=sdpB; Synonyms=yvaX; OrderedLocusNames=BSU33760; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->323|SDPB_BACSU|e-164|100.0|323/323| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 21->43| TM:REGION 84->106| TM:REGION 113->134| TM:REGION 155->177| TM:REGION 216->238| TM:REGION 252->274| SEG 26->38|sllgfstllvllf| SEG 248->270|lvlgilfhigiifsigivsfgli| RP:PFM:NREP 1 RP:PFM:REP 140->203|PF05090|7e-05|34.9|63/263|VKG_Carbox| HM:PFM:NREP 1 HM:PFM:REP 75->281|PF05090|1.7e-10|22.4|192/446|VKG_Carbox| GO:PFM:NREP 2 GO:PFM GO:0008488|"GO:gamma-glutamyl carboxylase activity"|PF05090|IPR007782| GO:PFM GO:0017187|"GO:peptidyl-glutamic acid carboxylation"|PF05090|IPR007782| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------1-------------1----------------------------------------------------------------------------------------------------------------------------------------------11----2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHcc //