[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : seaA
DDBJ      :seaA         conserved hypothetical protein
Swiss-Prot:YPHB_BACSU   RecName: Full=Uncharacterized protein yphB;

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->85 PF11364 * DUF3165 0.00014 25.0 48/82  
:BLT:SWISS 1->297 YPHB_BACSU e-146 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14201.1 GT:GENE seaA GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2391861..2392754) GB:FROM 2391861 GB:TO 2392754 GB:DIRECTION - GB:GENE seaA GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14201.1 GB:DB_XREF GOA:P50742 SubtiList:BG11442 UniProtKB/Swiss-Prot:P50742 GB:GENE:GENE seaA LENGTH 297 SQ:AASEQ MSDYIYPIIAGVIAGIATRLYMLKTDYRQYPTYVHGKVIHIALGLIAAGLGAIIMPALLQEEFTAITFLTLAATQFRDVRNMERNTLTQMDSYELVSRGSTYIEGIAIAFESRNYIVIFTALLTTSAYVFLSIWAAVIAAVVCFLLAMKFMSGSVLKDIVDIEYIKPRFDGPGLFVDNIYMMNIGLPEKQELILKHGMGFILTPKNFNSAATIANLGQRQAILFDVSNVLGVYRDSGEPSLTPIAKRDLNDGRVAVFVLPQIHHPETAVQIISNVPTLENAIRMPTEFIKNQDKVIG GT:EXON 1|1-297:0| SW:ID YPHB_BACSU SW:DE RecName: Full=Uncharacterized protein yphB; SW:GN Name=yphB; OrderedLocusNames=BSU22850; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->297|YPHB_BACSU|e-146|100.0|297/297| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 2->23| TM:REGION 35->57| TM:REGION 115->137| TM:REGION 142->164| SEG 39->59|ihialgliaaglgaiimpall| SEG 63->74|ftaitfltlaat| HM:PFM:NREP 1 HM:PFM:REP 38->85|PF11364|0.00014|25.0|48/82|DUF3165| OP:NHOMO 43 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111111111111-11111111111-1--------11-------------------------------------------------------------------------------------------2--1-----------2-------------------11111--111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 296-297| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEEcccEEEccEEEEEcccHHHHHHHHHcccEEEEccccHHHHHHHHHccHHHHHHHHHHHHHHEEEccccccccHHHHcccccccEEEEEEEEcccHHHHHHHHHHccHHHHHHHHHHHHccccccccc //