[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : sigM
DDBJ      :sigM         RNA polymerase ECF (extracytoplasmic function)-type sigma factor (sigma(M))
Swiss-Prot:SIGM_BACSU   RecName: Full=RNA polymerase sigma factor sigM;

Homologs  Archaea  0/68 : Bacteria  408/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.1a.4.13
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->152 1or7A PDBj 5e-10 29.3 %
:RPS:PDB   6->163 3dxjF PDBj 3e-21 12.0 %
:RPS:SCOP  4->68 1h3lA  a.177.1.1 * 2e-16 32.3 %
:RPS:SCOP  96->152 1k78A1  a.4.1.5 * 3e-06 15.8 %
:HMM:SCOP  3->92 1or7A2 a.177.1.1 * 1.2e-18 31.5 %
:HMM:SCOP  93->158 1s7oA_ a.4.13.3 * 1.9e-12 34.8 %
:RPS:PFM   6->71 PF04542 * Sigma70_r2 2e-06 30.3 %
:RPS:PFM   106->152 PF08281 * Sigma70_r4_2 3e-08 48.9 %
:HMM:PFM   6->72 PF04542 * Sigma70_r2 9.2e-21 29.9 67/71  
:HMM:PFM   105->152 PF08281 * Sigma70_r4_2 1.4e-14 45.8 48/54  
:BLT:SWISS 1->163 SIGM_BACSU 1e-92 100.0 %
:PROS 28->58|PS01063|SIGMA70_ECF

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12791.1 GT:GENE sigM GT:PRODUCT RNA polymerase ECF (extracytoplasmic function)-type sigma factor (sigma(M)) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1029577..1030068) GB:FROM 1029577 GB:TO 1030068 GB:DIRECTION - GB:GENE sigM GB:PRODUCT RNA polymerase ECF (extracytoplasmic function)-type sigma factor (sigma(M)) GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 14651641, 14769884; Product type r: regulator GB:PROTEIN_ID CAB12791.1 GB:DB_XREF GOA:O07582 HSSP:1H3L InterPro:IPR013249 SubtiList:BG13019 UniProtKB/Swiss-Prot:O07582 GB:GENE:GENE sigM LENGTH 163 SQ:AASEQ MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDYVRKHKKEVTISDDLIGSLFQNAVQSPAHQVEIKEVLTGYMSELPDNYREALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRLKALYNRGVNDE GT:EXON 1|1-163:0| SW:ID SIGM_BACSU SW:DE RecName: Full=RNA polymerase sigma factor sigM; SW:GN Name=sigM; Synonyms=yhdM; OrderedLocusNames=BSU09520; SW:KW Complete proteome; DNA-binding; Sigma factor; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->163|SIGM_BACSU|1e-92|100.0|163/163| GO:SWS:NREP 5 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0016987|"GO:sigma factor activity"|Sigma factor| GO:SWS GO:0006355|"GO:regulation of transcription, DNA-dependent"|Sigma factor| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 28->58|PS01063|SIGMA70_ECF|PDOC00814| BL:PDB:NREP 1 BL:PDB:REP 30->152|1or7A|5e-10|29.3|123/181| RP:PDB:NREP 1 RP:PDB:REP 6->163|3dxjF|3e-21|12.0|158/349| RP:PFM:NREP 2 RP:PFM:REP 6->71|PF04542|2e-06|30.3|66/70|Sigma70_r2| RP:PFM:REP 106->152|PF08281|3e-08|48.9|47/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 6->72|PF04542|9.2e-21|29.9|67/71|Sigma70_r2| HM:PFM:REP 105->152|PF08281|1.4e-14|45.8|48/54|Sigma70_r4_2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 4->68|1h3lA|2e-16|32.3|65/75|a.177.1.1| RP:SCP:REP 96->152|1k78A1|3e-06|15.8|57/63|a.4.1.5| HM:SCP:REP 3->92|1or7A2|1.2e-18|31.5|89/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 93->158|1s7oA_|1.9e-12|34.8|66/0|a.4.13.3|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 990 OP:NHOMOORG 410 OP:PATTERN -------------------------------------------------------------------- 25B1322122222-11111-12112411111232222111111112-12---21111---21411313342---------111-----34C4-4-----3193657893B---------------1212111113133353111411-1----1111-------12-111-------------111--12-11488888489-9A956A23556598A33176231--111Q6--------------------1-------------------1--------1222------------------------------------12871411121123144-441111634--4--21995273-3212142-1-5-3-----1111114543313222211111111112-44A44836221-12212222231313231113313321-11111111-112111--------------------------------1-2-1------------------2----------1----11---111-1121111-1--11-1111111-11112321--11------------1----332332-2---------------------------1--2-2112112222223121211211111------2------------1------------------------------1-------1----------------------------------------3-----------1-1111---1----1---------------1111-2-1------111---------1-11-1111133211---2-21---------1---4444--------212--------------------------1--------331 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 97.5 SQ:SECSTR ####HHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHHHHHHHH DISOP:02AL 158-163| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccc //