[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : sigV
DDBJ      :sigV         RNA polymerase ECF(extracytoplasmic function)-type sigma factor (sigma(V))
Swiss-Prot:SIGV_BACSU   RecName: Full=RNA polymerase sigma factor sigV;

Homologs  Archaea  0/68 : Bacteria  389/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->152 1or7B PDBj 4e-10 31.4 %
:RPS:PDB   15->166 3dxjF PDBj 4e-19 13.2 %
:RPS:SCOP  17->77 1h3lA  a.177.1.1 * 3e-13 34.4 %
:RPS:SCOP  105->157 1ku3A  a.4.13.2 * 2e-09 22.6 %
:HMM:SCOP  3->77 1h3lA_ a.177.1.1 * 6.7e-14 29.3 %
:HMM:SCOP  98->162 1s7oA_ a.4.13.3 * 1.8e-14 40.0 %
:RPS:PFM   108->154 PF08281 * Sigma70_r4_2 1e-07 55.3 %
:HMM:PFM   105->155 PF08281 * Sigma70_r4_2 1.2e-18 51.0 51/54  
:HMM:PFM   15->81 PF04542 * Sigma70_r2 2.1e-15 25.4 67/71  
:BLT:SWISS 1->166 SIGV_BACSU 5e-92 100.0 %
:PROS 36->67|PS01063|SIGMA70_ECF

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14654.1 GT:GENE sigV GT:PRODUCT RNA polymerase ECF(extracytoplasmic function)-type sigma factor (sigma(V)) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2769850..2770350 GB:FROM 2769850 GB:TO 2770350 GB:DIRECTION + GB:GENE sigV GB:PRODUCT RNA polymerase ECF(extracytoplasmic function)-type sigma factor (sigma(V)) GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16274938; Product type r: regulator GB:PROTEIN_ID CAB14654.1 GB:DB_XREF GOA:O05404 InterPro:IPR013249 SubtiList:BG11974 UniProtKB/Swiss-Prot:O05404 GB:GENE:GENE sigV LENGTH 166 SQ:AASEQ MKKKQTTKALLVTCITDHKQDFYRLAFSYVKNQDDALDIVQESIKKALSSVETVRNPETIKSWFYKILVRTAIDFLRKQKKIRVMDDETIEFLSKGKEDHYKDTDLHEALDELPYRYKTIIILRFFEDLKLEEIAEITGENTNTVKTRLYRALKLMRIQLTKEDLS GT:EXON 1|1-166:0| SW:ID SIGV_BACSU SW:DE RecName: Full=RNA polymerase sigma factor sigV; SW:GN Name=sigV; OrderedLocusNames=BSU27120; SW:KW Activator; Complete proteome; DNA-binding; Sigma factor;Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->166|SIGV_BACSU|5e-92|100.0|166/166| GO:SWS:NREP 5 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0016987|"GO:sigma factor activity"|Sigma factor| GO:SWS GO:0006355|"GO:regulation of transcription, DNA-dependent"|Sigma factor| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 36->67|PS01063|SIGMA70_ECF|PDOC00814| BL:PDB:NREP 1 BL:PDB:REP 35->152|1or7B|4e-10|31.4|105/164| RP:PDB:NREP 1 RP:PDB:REP 15->166|3dxjF|4e-19|13.2|152/349| RP:PFM:NREP 1 RP:PFM:REP 108->154|PF08281|1e-07|55.3|47/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 105->155|PF08281|1.2e-18|51.0|51/54|Sigma70_r4_2| HM:PFM:REP 15->81|PF04542|2.1e-15|25.4|67/71|Sigma70_r2| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 17->77|1h3lA|3e-13|34.4|61/75|a.177.1.1| RP:SCP:REP 105->157|1ku3A|2e-09|22.6|53/61|a.4.13.2| HM:SCP:REP 3->77|1h3lA_|6.7e-14|29.3|75/75|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 98->162|1s7oA_|1.8e-14|40.0|65/0|a.4.13.3|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 840 OP:NHOMOORG 391 OP:PATTERN -------------------------------------------------------------------- 43A1823322221-11111-12112311111222222211311111-12111222112--11212223334---------41------5575-311-----634383618---------------2222111113122231--13-111-1111111------11111111------------111---1-22588888479-87846735556485822375321--11-L7--------------------1-------------------------1111111----------------------------11---111-1921722222224133366-321363--9-1229B721315121-2121---1----------12-1111---------------2------1---1------11111211-21-----1111-1-11111111-11-1------------------------------------1-1--1--------1111--12111111----1----22----11--1---11-1-11---------1111-111----1--1-----------11-33332--31------------------------111111-3313122111112211111111121---1111--------------------------------------------------------------------------------------------2---------111--11111111111-111----------1-11111---21111111----------21--22222223211-----------------1--2211--------1-1--------------------------1--------23- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 91.6 SQ:SECSTR ##############HHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHHHHHHH DISOP:02AL 1-6, 163-166| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccc //