[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : sigZ
DDBJ      :sigZ         RNA polymerase ECF(extracytoplasmic function)-type sigma factor (sigma-Z)
Swiss-Prot:SIGZ_BACSU   RecName: Full=RNA polymerase sigma factor sigZ;

Homologs  Archaea  0/68 : Bacteria  276/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.1a.4.13
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->147 1or7A PDBj 1e-08 31.0 %
:RPS:PDB   4->155 3dxjF PDBj 2e-16 9.2 %
:RPS:SCOP  4->69 1h3lA  a.177.1.1 * 7e-11 22.7 %
:RPS:SCOP  100->150 1k78A1  a.4.1.5 * 6e-08 17.6 %
:HMM:SCOP  3->91 1or7A2 a.177.1.1 * 1.2e-12 28.4 %
:HMM:SCOP  86->156 1rp3A2 a.4.13.2 * 2.1e-13 42.3 %
:RPS:PFM   98->150 PF08281 * Sigma70_r4_2 4e-07 43.4 %
:HMM:PFM   99->150 PF08281 * Sigma70_r4_2 2e-18 46.2 52/54  
:HMM:PFM   6->72 PF04542 * Sigma70_r2 5.2e-13 20.9 67/71  
:BLT:SWISS 1->176 SIGZ_BACSU e-100 100.0 %
:PROS 28->59|PS01063|SIGMA70_ECF

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14625.1 GT:GENE sigZ GT:PRODUCT RNA polymerase ECF(extracytoplasmic function)-type sigma factor (sigma-Z) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2742244..2742774) GB:FROM 2742244 GB:TO 2742774 GB:DIRECTION - GB:GENE sigZ GB:PRODUCT RNA polymerase ECF(extracytoplasmic function)-type sigma factor (sigma-Z) GB:FUNCTION 16.3: Control 16.12: Sense GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11700344, 15019740; Product type r: regulator GB:PROTEIN_ID CAB14625.1 GB:DB_XREF GOA:O05409 InterPro:IPR013249 SubtiList:BG11976 UniProtKB/Swiss-Prot:O05409 GB:GENE:GENE sigZ LENGTH 176 SQ:AASEQ MNIEDLWDQFHQPLKTYISHRVNDQSIVDDLLQIVFMKIQVHLPNLIDEQKIDSWIYRITRNTIIDFYRTKKTSEILPDVLHFNDSAEEENFTKEATVCIRSTIKRLPEKYREALELTDFQGLSQKELSEKLGISYSGAKSRVQRGRGKLKQLLEGCCHIEADRYGNIVDFRILKE GT:EXON 1|1-176:0| SW:ID SIGZ_BACSU SW:DE RecName: Full=RNA polymerase sigma factor sigZ; SW:GN Name=sigZ; OrderedLocusNames=BSU26840; SW:KW Complete proteome; DNA-binding; Sigma factor; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->176|SIGZ_BACSU|e-100|100.0|176/176| GO:SWS:NREP 5 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0016987|"GO:sigma factor activity"|Sigma factor| GO:SWS GO:0006355|"GO:regulation of transcription, DNA-dependent"|Sigma factor| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 28->59|PS01063|SIGMA70_ECF|PDOC00814| BL:PDB:NREP 1 BL:PDB:REP 28->147|1or7A|1e-08|31.0|116/181| RP:PDB:NREP 1 RP:PDB:REP 4->155|3dxjF|2e-16|9.2|152/349| RP:PFM:NREP 1 RP:PFM:REP 98->150|PF08281|4e-07|43.4|53/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 99->150|PF08281|2e-18|46.2|52/54|Sigma70_r4_2| HM:PFM:REP 6->72|PF04542|5.2e-13|20.9|67/71|Sigma70_r2| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 4->69|1h3lA|7e-11|22.7|66/75|a.177.1.1| RP:SCP:REP 100->150|1k78A1|6e-08|17.6|51/63|a.4.1.5| HM:SCP:REP 3->91|1or7A2|1.2e-12|28.4|88/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 86->156|1rp3A2|2.1e-13|42.3|71/0|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 448 OP:NHOMOORG 277 OP:PATTERN -------------------------------------------------------------------- 52211111111-1-111----1--23-----2223211321111-1111---111-1---1-1-3211212-------------------23-5-----31616553417----------------1-------2----11---1-211-1111111------1121111------1------------1-11244444344-344334112233333121-4221--11-B2-------------------------------------------------1-------------------------------11---111--13-2-------2-22-11----311--2--2-452211121---1----2-2-----------1-1--11--1---------------1--1---1------11-121---1211----------------------1--------------------------------------11111111211111111111111111111-111--11----11-211--11-1211-----------1-12-----1---11----11--1-1-1111121-21----------------------------11-11-11-------21------12-----------------------------------------------------11------1----------------------------------------3------11---1----------------------------1---------1------------------221111111-111----------------1---1111-------------------------------------1-1--1----3- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 88.6 SQ:SECSTR ###HHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHHHHHH################# DISOP:02AL 176-177| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccEEEEEEEcc //