[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : sipV
DDBJ      :sipV         type I signal peptidase
Swiss-Prot:LEPV_BACSU   RecName: Full=Signal peptidase I V;         Short=SPase I;         EC=3.4.21.89;AltName: Full=Leader peptidase I;

Homologs  Archaea  0/68 : Bacteria  470/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
b.87.1
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->162 1b12B PDBj 4e-11 38.5 %
:RPS:PDB   21->164 1b12D PDBj 8e-17 30.6 %
:RPS:SCOP  21->162 1b12A  b.87.1.2 * 1e-24 38.7 %
:HMM:SCOP  21->165 1b12A_ b.87.1.2 * 1.1e-42 43.4 %
:RPS:PFM   30->85 PF00717 * Peptidase_S24 4e-10 52.7 %
:RPS:PFM   62->162 PF10502 * Peptidase_S26 6e-15 46.7 %
:HMM:PFM   29->97 PF00717 * Peptidase_S24 5.5e-21 45.3 64/70  
:HMM:PFM   70->165 PF10502 * Peptidase_S26 2.3e-16 31.4 86/138  
:BLT:SWISS 1->168 LEPV_BACSU 1e-95 100.0 %
:PROS 32->39|PS00501|SPASE_I_1
:PROS 75->87|PS00760|SPASE_I_2
:PROS 136->149|PS00761|SPASE_I_3
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12889.1 GT:GENE sipV GT:PRODUCT type I signal peptidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1122175..1122681 GB:FROM 1122175 GB:TO 1122681 GB:DIRECTION + GB:GENE sipV GB:PRODUCT type I signal peptidase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.13: Shape GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11309398, 14568161, 9325333; Product type e: enzyme GB:PROTEIN_ID CAB12889.1 GB:DB_XREF GOA:O07560 HSSP:1KN9 InterPro:IPR019758 SubtiList:BG12674 UniProtKB/Swiss-Prot:O07560 GB:GENE:GENE sipV LENGTH 168 SQ:AASEQ MKKRFWFLAGVVSVVLAIQVKNAVFIDYKVEGVSMNPTFQEGNELLVNKFSHRFKTIHRFDIVLFKGPDHKVLIKRVIGLPGETIKYKDDQLYVNGKQVAEPFLKHLKSVSAGSHVTGDFSLKDVTGTSKVPKGKYFVVGDNRIYSFDSRHFGPIREKNIVGVISDAE GT:EXON 1|1-168:0| SW:ID LEPV_BACSU SW:DE RecName: Full=Signal peptidase I V; Short=SPase I; EC=3.4.21.89;AltName: Full=Leader peptidase I; SW:GN Name=sipV; Synonyms=yhjF; OrderedLocusNames=BSU10490; SW:KW Cell membrane; Complete proteome; Hydrolase; Membrane; Protease;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->168|LEPV_BACSU|1e-95|100.0|168/168| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 32->39|PS00501|SPASE_I_1|PDOC00418| PROS 75->87|PS00760|SPASE_I_2|PDOC00418| PROS 136->149|PS00761|SPASE_I_3|PDOC00418| TM:NTM 1 TM:REGION 5->27| BL:PDB:NREP 1 BL:PDB:REP 24->162|1b12B|4e-11|38.5|135/211| RP:PDB:NREP 1 RP:PDB:REP 21->164|1b12D|8e-17|30.6|144/222| RP:PFM:NREP 2 RP:PFM:REP 30->85|PF00717|4e-10|52.7|55/70|Peptidase_S24| RP:PFM:REP 62->162|PF10502|6e-15|46.7|90/101|Peptidase_S26| HM:PFM:NREP 2 HM:PFM:REP 29->97|PF00717|5.5e-21|45.3|64/70|Peptidase_S24| HM:PFM:REP 70->165|PF10502|2.3e-16|31.4|86/138|Peptidase_S26| RP:SCP:NREP 1 RP:SCP:REP 21->162|1b12A|1e-24|38.7|142/239|b.87.1.2| HM:SCP:REP 21->165|1b12A_|1.1e-42|43.4|145/247|b.87.1.2|1/1|LexA/Signal peptidase| OP:NHOMO 825 OP:NHOMOORG 488 OP:PATTERN -------------------------------------------------------------------- 3351------------------11-------------1---------------1---1--21----------111-1111211-1111----------------------------------------1-------11111111214322223112211111122222222--11-----11-223--11-1134555665645556852133245562232311333333432222222222222222333241211111222331111211123111232222222211111111111222222222222223322233321332422222223222333244341413323113311111211111111--1112211----1-1111--1112111111111111-11-11-1-111-111-11-112-----1-------------------------11---1-111----1111-1111111-----1------11111112112----1121------112-1---112------1-----111-2111-------------1131211111211111111211211-----112-------------------------------111111--2222--1111--111--1--11111---------------------------------------------------------------------------------------------22222111111112---------------111111----11222211111111111111111111111--------------1111111111----1112221111------------------------111----1--------------1-1 ------------------------------------------------------------------------------------------------------------1-------------------------------------------------1-----------------11161--113345-4511----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 86.9 SQ:SECSTR ###################cccccEEEEEccccTTTTTccTTEEEEEEEcEEEEEcccTTcEEEEEcTTTcEEEEEEEEcTTcEEEEETTTTEEEEEccccEEEEEEcTTccccGGGccccTTccTTEEEccTTEEEEEcccTTccccHHHHccEEGGGEEEEEE### DISOP:02AL 166-168| PSIPRED cccEEEHHHHHHHHHHHHHHHHHEEEEEEEccHHHccccccccEEEEEEEEcccccccccEEEEEEcccccEEEEEEEEccccEEEEEccEEEEccEEEccccccccccccccccccccccccccccEEEEcccEEEEEEccccccccccEEccccHHHEEEEEEccc //