[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : skfE
DDBJ      :skfE         sporulation killing factor biosynthesis and export; ABC transporter (binding protein)
Swiss-Prot:SKFE_BACSU   RecName: Full=SkfA peptide export ATP-binding protein skfE;         EC=3.6.3.25;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:239 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->212 2yyzA PDBj 1e-28 33.5 %
:RPS:PDB   3->213 3b5jA PDBj 7e-40 22.5 %
:RPS:SCOP  3->213 1b0uA  c.37.1.12 * 5e-38 25.6 %
:HMM:SCOP  6->210 1ii8.1 c.37.1.12 * 1.1e-58 36.0 %
:RPS:PFM   43->160 PF00005 * ABC_tran 5e-15 38.3 %
:HMM:PFM   43->160 PF00005 * ABC_tran 4.2e-24 36.1 108/118  
:HMM:PFM   11->54 PF03193 * DUF258 9.6e-06 23.3 43/161  
:BLT:SWISS 1->239 SKFE_BACSU e-139 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11989.1 GT:GENE skfE GT:PRODUCT sporulation killing factor biosynthesis and export; ABC transporter (binding protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 216913..217632 GB:FROM 216913 GB:TO 217632 GB:DIRECTION + GB:GENE skfE GB:PRODUCT sporulation killing factor biosynthesis and export; ABC transporter (binding protein) GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; Product type t: transporter GB:PROTEIN_ID CAB11989.1 GB:DB_XREF GOA:O31427 HSSP:1L7V InterPro:IPR003593 SubtiList:BG12718 UniProtKB/Swiss-Prot:O31427 GB:GENE:GENE skfE LENGTH 239 SQ:AASEQ MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTTIRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHPGKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGLDIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQAEWRKEVIRLLGEWSDE GT:EXON 1|1-239:0| SW:ID SKFE_BACSU SW:DE RecName: Full=SkfA peptide export ATP-binding protein skfE; EC=3.6.3.25; SW:GN Name=skfE; Synonyms=ybdA; OrderedLocusNames=BSU01950; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase; Membrane;Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->239|SKFE_BACSU|e-139|100.0|239/239| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 4->212|2yyzA|1e-28|33.5|209/358| RP:PDB:NREP 1 RP:PDB:REP 3->213|3b5jA|7e-40|22.5|209/243| RP:PFM:NREP 1 RP:PFM:REP 43->160|PF00005|5e-15|38.3|115/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 43->160|PF00005|4.2e-24|36.1|108/118|ABC_tran| HM:PFM:REP 11->54|PF03193|9.6e-06|23.3|43/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->213|1b0uA|5e-38|25.6|211/258|c.37.1.12| HM:SCP:REP 6->210|1ii8.1|1.1e-58|36.0|203/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 49871 OP:NHOMOORG 1169 OP:PATTERN ZXLBQNIMVVWTVRWPoKUPOQPa*OTfjYfTIADEECHGHFDTaPYkIR**hAUhRXaPSMJFa29A UdvQ*bebppsXcTXSRNN-NlBBW*OOOOONvporz***U*c*r**gshZK***SSkGGtx*g*s****gcYXX*bacO*hlCBD9CRRNM4RHJK--HJSMLMfPcSS6877878AABAAAAIURMTZMLSRXQovv**MLK*crkorhgldjTVMHIJNIdfbi***ZJNHKIEJQIMJHoeeaWsh9ag*************************frx**mw****z***YmmnjnljlmmmmmlWZVbd*eccz*ZQeYmyxRS**cZPZmihiksrvvsnvzyxpuqslortnrqccbbbcccdcbbbzqqhggtsuss***********k*mu***fllj*tiut*mtWJ**ugYbioTaibprQVZZOiVUULONKLNeW***ZTv****************-nt*kg*q***UC**************JGM**********NMNNNNNNxUXKQiXz66667666557998CC7999868897686IFCCCF***********tzxzt********i********AQz*p*mump******anhMZKPjRKKIIJJIPQNXmic**WgXvfWltXXkLfcaTXXgTYbYYdu*Y*JOOTGMMMNJHA8DEDEDEEJUGEINMrpvSsUdLWLuQWaZXNVbWWUWRYYTYXb6-FJRNN32-333****Y**z*******zy-*zy**********xxyyxv*****kjfqqppsrssrtpqsqpq*tpqvvtwT4************35FJDGCDEOPPORM*m*YYXbYaIQUQQVSXfPRSQRJVGMQtbywsvt***t**yxk***IFFDDGFEFKiqo*tuuuu*****OROMONMNPPHFFF58PUQPJJMM99888788*BaA997B-8BA8DBBAA9BBJA8B668altYWo*puoGeN --66spK-VG8HQcTIGECLNUMTQVSKJBGDGNLLBHEEFFEGGEGIJMNPbPGJLAGCEDA8A487-7D779AAE2BC9CBCBI36-HK7GFAAA99BA38MHD6PimyWbblbpKLIEPYOtvFzH**p4oW*MMODmJK*eFOKHGdFG*JdVSyKk*JsQcH*dm*WbjWCCHG*FFGMK*mt*E*rJK*m*zQ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 237-239| PSIPRED ccEEEEEccEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEcccccccccHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHHHccccEEEEEEEcccccc //