[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : skfF
DDBJ      :skfF         sporulation killing factor biosynthesis and export; ABC transporter (permease)
Swiss-Prot:SKFF_BACSU   RecName: Full=Putative bacteriocin-skfA transport system permease protein skfF;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:447 amino acids
:PSIPRED
:RPS:PFM   143->197 PF03839 * Sec62 8e-04 33.3 %
:BLT:SWISS 1->447 SKFF_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11990.2 GT:GENE skfF GT:PRODUCT sporulation killing factor biosynthesis and export; ABC transporter (permease) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 217697..219040 GB:FROM 217697 GB:TO 219040 GB:DIRECTION + GB:GENE skfF GB:PRODUCT sporulation killing factor biosynthesis and export; ABC transporter (permease) GB:FUNCTION 16.1: Circulate 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15812018, 15849754, 16816204, 16850406, 17069462, 17184776; Product type t : transporter GB:PROTEIN_ID CAB11990.2 GB:DB_XREF GOA:O31428 SubtiList:BG12719 UniProtKB/Swiss-Prot:O31428 GB:GENE:GENE skfF LENGTH 447 SQ:AASEQ MPFLIMLLFVGAIGFQVSFVSRSTTWDMSIAGWVLTGVFILYTAFGLFSNRLPSQMADIIWLYGTATSFSKVVYSVLFFSVTWKALLWIISAIFGDVLIVLLSGDHINLLGRSIIFVGLFFIAEVWLMSVSCARTVKKMKRVYVLVFLLMLGIYSICLYRFFFLQHSSGIWESIARFISGVGLVFDTLSPLYVVVFIGIITVSFMTIAFTSRQVEMKESLVKEAEFWEEFQERQFGSGQIIQKPKTTWWGLQGLNGIWSFLWLELLLFKKYLFFHSIHTVMLSGVFYVVIFMYPEWFYLLFFLIVSAVMLSSYYSGIVRHSQSGTLHLFPGALWKKIIILELTNTVWLYILYCVSITFMAVGNLVYWYIYGLGIYIWFMTIRLFAFTHTNRNDIKLSLPQYYKSFFMALGLSGICLYVIHLLTADWYTLVVVVCIGSLSWCLFYRFR GT:EXON 1|1-447:0| SW:ID SKFF_BACSU SW:DE RecName: Full=Putative bacteriocin-skfA transport system permease protein skfF; SW:GN Name=skfF; Synonyms=ybdB; OrderedLocusNames=BSU01960; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->447|SKFF_BACSU|0.0|100.0|447/447| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 11 TM:REGION 1->23| TM:REGION 28->50| TM:REGION 77->99| TM:REGION 111->133| TM:REGION 142->164| TM:REGION 183->205| TM:REGION 262->284| TM:REGION 297->319| TM:REGION 337->359| TM:REGION 367->388| TM:REGION 413->435| SEG 260->274|flwlelllfkkylff| SEG 366->377|ywyiyglgiyiw| RP:PFM:NREP 1 RP:PFM:REP 143->197|PF03839|8e-04|33.3|54/206|Sec62| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF03839|IPR004728| GO:PFM GO:0015031|"GO:protein transport"|PF03839|IPR004728| GO:PFM GO:0016021|"GO:integral to membrane"|PF03839|IPR004728| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHEHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcHHHHHEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHEEEEcc //