[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : skfG
DDBJ      :skfG         sporulation killing factor biosynthesis and export
Swiss-Prot:SKFG_BACSU   RecName: Full=Uncharacterized protein skfG;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.1a.118.15
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   35->125 3ea5B PDBj 2e-04 12.1 %
:RPS:SCOP  23->161 1l5jA1  a.118.15.1 * 5e-05 14.0 %
:HMM:SCOP  15->125 1te4A_ a.118.1.16 * 4.2e-09 25.7 %
:HMM:PFM   41->74 PF07903 * PaRep2a 0.00078 38.2 34/122  
:BLT:SWISS 1->171 SKFG_BACSU 1e-96 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11991.2 GT:GENE skfG GT:PRODUCT sporulation killing factor biosynthesis and export GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 219087..219602 GB:FROM 219087 GB:TO 219602 GB:DIRECTION + GB:GENE skfG GB:PRODUCT sporulation killing factor biosynthesis and export GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15812018, 16816204, 17069462, 17184776; Product type ph: phenotype GB:PROTEIN_ID CAB11991.2 GB:DB_XREF GOA:O31429 SubtiList:BG12720 UniProtKB/Swiss-Prot:O31429 GB:GENE:GENE skfG LENGTH 171 SQ:AASEQ MNSNGDKLSLSVQNLANTNEITIVQAIGELKKSGKDAIPVLVEALKEEGSLCNIAAAVLGEFGEDASEAAEELSCLLKSHAEDTRMAAAISLMRIGKPSLPFVIKIAQESEGQSCFWASWCIAWIDPSCIEPKMYKCLKYEHEHPSGIVAPFAAEEALGKLIAFQLKDKED GT:EXON 1|1-171:0| SW:ID SKFG_BACSU SW:DE RecName: Full=Uncharacterized protein skfG; SW:GN Name=skfG; Synonyms=ybdD; OrderedLocusNames=BSU01970; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->171|SKFG_BACSU|1e-96|100.0|171/171| RP:PDB:NREP 1 RP:PDB:REP 35->125|3ea5B|2e-04|12.1|91/859| HM:PFM:NREP 1 HM:PFM:REP 41->74|PF07903|0.00078|38.2|34/122|PaRep2a| RP:SCP:NREP 1 RP:SCP:REP 23->161|1l5jA1|5e-05|14.0|121/160|a.118.15.1| HM:SCP:REP 15->125|1te4A_|4.2e-09|25.7|109/111|a.118.1.16|1/1|ARM repeat| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 53.2 SQ:SECSTR ##################################HHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHTcTTccHHHHHHHHHHHHTTTHHHHHHHHHccHHHHHHHHHHHHHHHTcc############################################## DISOP:02AL 171-172| PSIPRED ccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc //