[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spmA
DDBJ      :spmA         spore maturation protein
Swiss-Prot:SPMA_BACSU   RecName: Full=Spore maturation protein A;

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->151 PF07670 * Gate 1.6e-14 16.8 101/109  
:BLT:SWISS 1->180 SPMA_BACSU e-100 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14250.1 GT:GENE spmA GT:PRODUCT spore maturation protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2422805..2423395) GB:FROM 2422805 GB:TO 2423395 GB:DIRECTION - GB:GENE spmA GB:PRODUCT spore maturation protein GB:FUNCTION 16.8: Protect 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15849754, 16850406, 7642500; Product type cp: cell process GB:PROTEIN_ID CAB14250.1 GB:DB_XREF GOA:P35157 InterPro:IPR011642 SubtiList:BG10528 UniProtKB/Swiss-Prot:P35157 GB:GENE:GENE spmA LENGTH 196 SQ:AASEQ MVNIIWVSLTVIGLVFAMCNGTLQDVNEAVFKGAKEAITISFGLMSVLVFWLGLMKIAEQSGLLDIFSRMCRPFISKLFPDIPPDHPAMGYILSNLMANFFGLGNAATPLGIKAMEQMKKLNGNRSEASRSMITFLAVNTSCITLIPTTVIAVRMAYSSKTPTDIVGPSILATLISGIGAIIIDRYFYYRRKKKGR GT:EXON 1|1-196:0| SW:ID SPMA_BACSU SW:DE RecName: Full=Spore maturation protein A; SW:GN Name=spmA; Synonyms=ypuJ; OrderedLocusNames=BSU23180; SW:KW Cell membrane; Complete proteome; Membrane; Sporulation;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->180|SPMA_BACSU|e-100|100.0|180/196| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 4->26| TM:REGION 36->58| TM:REGION 132->154| TM:REGION 165->187| SEG 181->194|iiidryfyyrrkkk| HM:PFM:NREP 1 HM:PFM:REP 44->151|PF07670|1.6e-14|16.8|101/109|Gate| OP:NHOMO 169 OP:NHOMOORG 168 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---1-11--11111--------------------------------------1---------------1-----1--------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------11211111111111111111111111--1--11111111111111111-------------------------------------------------------------------------------------------1-------------------------------------11111------------------------1111--1111-1111---1----1----1------------1---------------1-1--------1---1----------------------------------1----1111111111111111111----1-1--------------------------------------------------------------------------------------------1-----1111-1----------------------------1-11111111111111111----------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 118-128, 194-196| PSIPRED cHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //