[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spmB
DDBJ      :spmB         spore maturation protein
Swiss-Prot:SPMB_BACSU   RecName: Full=Spore maturation protein B;

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:HMM:PFM   46->138 PF07670 * Gate 9.3e-10 17.2 93/109  
:HMM:PFM   8->60 PF02790 * COX2_TM 7.3e-05 31.4 51/84  
:BLT:SWISS 1->178 SPMB_BACSU 3e-95 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14249.2 GT:GENE spmB GT:PRODUCT spore maturation protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2422264..2422800) GB:FROM 2422264 GB:TO 2422800 GB:DIRECTION - GB:GENE spmB GB:PRODUCT spore maturation protein GB:FUNCTION 16.8: Protect 16.13: Shape 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15849754, 16850406, 7642500; Product type cp: cell process GB:PROTEIN_ID CAB14249.2 GB:DB_XREF GOA:P35158 InterPro:IPR011642 SubtiList:BG10529 UniProtKB/Swiss-Prot:P35158 GB:GENE:GENE spmB LENGTH 178 SQ:AASEQ MEIINWLSLAMIPIIIAGILLYGTIKKVPTYESFVEGGKEGIEIAFSIIPYLVGMLVAITVFRSSGALDFIMDLLKPAFSAIGIPAEVVPLALIRPISGTAALGMTTDLIAVYGPDSFIGRLASVMQGSTDTTLYVLTVYFGAVGIKKMGDALKVGLLADLIGVVASIIIVTLLFGSA GT:EXON 1|1-178:0| SW:ID SPMB_BACSU SW:DE RecName: Full=Spore maturation protein B; SW:GN Name=spmB; Synonyms=ypuK; OrderedLocusNames=BSU23170; SW:KW Cell membrane; Complete proteome; Membrane; Sporulation;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|SPMB_BACSU|3e-95|100.0|178/178| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 3->25| TM:REGION 42->64| TM:REGION 69->91| TM:REGION 153->175| HM:PFM:NREP 2 HM:PFM:REP 46->138|PF07670|9.3e-10|17.2|93/109|Gate| HM:PFM:REP 8->60|PF02790|7.3e-05|31.4|51/84|COX2_TM| OP:NHOMO 172 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---1-11--11111--------------------------------------1---------------1-----1--------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------12211111111111111111111111--1--11111111111111111-------------------------------------------------------------------------------------------1-------------------------------------11111------------------------1111--1111-1111---1----1----2------------1---------------1-1--------1---1----------------------------------1----1111111111111111111----1-1--------------------------------------------------------------------------------------------1-----1111-1----------------------------1-11111111111111111----------------------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //