[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spo0M
DDBJ      :spo0M        sporulation-control gene
Swiss-Prot:SP0M_BACSU   RecName: Full=Sporulation-control protein spo0M;AltName: Full=Stage 0 sporulation protein M;

Homologs  Archaea  1/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.18
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   17->107 1cf1B PDBj 3e-10 24.4 %
:HMM:SCOP  17->104 1g4mA2 b.1.18.11 * 1.3e-05 25.3 %
:RPS:PFM   4->183 PF07070 * Spo0M 1e-50 53.9 %
:HMM:PFM   4->221 PF07070 * Spo0M 1.5e-100 54.6 218/218  
:BLT:SWISS 1->258 SP0M_BACSU e-126 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12704.2 GT:GENE spo0M GT:PRODUCT sporulation-control gene GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(953373..954149) GB:FROM 953373 GB:TO 954149 GB:DIRECTION - GB:GENE spo0M GB:PRODUCT sporulation-control gene GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 9795118; Product type r : regulator GB:PROTEIN_ID CAB12704.2 GB:DB_XREF GOA:P71088 InterPro:IPR009776 SubtiList:BG12229 UniProtKB/Swiss-Prot:P71088 GB:GENE:GENE spo0M LENGTH 258 SQ:AASEQ MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPITVGKVEVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDTEELEEVLEEILDQYAE GT:EXON 1|1-258:0| SW:ID SP0M_BACSU SW:DE RecName: Full=Sporulation-control protein spo0M;AltName: Full=Stage 0 sporulation protein M; SW:GN Name=spo0M; Synonyms=ygaI; OrderedLocusNames=BSU08760; SW:KW Complete proteome; Direct protein sequencing; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->258|SP0M_BACSU|e-126|100.0|258/258| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| SEG 188->205|ldeleliflldedgleii| SEG 238->253|eledteeleevleeil| RP:PDB:NREP 1 RP:PDB:REP 17->107|1cf1B|3e-10|24.4|90/360| RP:PFM:NREP 1 RP:PFM:REP 4->183|PF07070|1e-50|53.9|180/212|Spo0M| HM:PFM:NREP 1 HM:PFM:REP 4->221|PF07070|1.5e-100|54.6|218/218|Spo0M| HM:SCP:REP 17->104|1g4mA2|1.3e-05|25.3|87/0|b.1.18.11|1/1|E set domains| OP:NHOMO 88 OP:NHOMOORG 70 OP:PATTERN ------------------------1------------------------------------------- ------------------------------------1----1111---------------12--2111321-------------------------------------------------------------------------1-----------------------1--------------1--------1-111111-1-111111----111112331111------11------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--1---1111---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------22211111122222------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 34.9 SQ:SECSTR ################cEEEEEccEETTEEccEEEEEEEcHHHHTTcEEEEEEEEEEEEcccEEEEEEEEEEEEEccHHHHHHHHHHc#TTEEEEEEcccccccccE####################################################################################################################################################### DISOP:02AL 258-259| PSIPRED ccHHHHHHHHccccccEEEEEEccccEEcccEEEEEEEEEcccHHHHEEEEEEEEEEEEEEEEccccEEEEEEEEEEEccccEEEccccEEEEEEEEEccccccccccccEEEEEEEEEEcccccccccccEEEcccHHHHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEEEccccccccccEEEEEEEEEcccEEEEEEEEcccccccHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHcc //