[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spoIIIAD
DDBJ      :spoIIIAD     stage III sporulation protein
Swiss-Prot:SP3AD_BACSU  RecName: Full=Stage III sporulation protein AD;

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   73->129 PF06686 * SpoIIIAC 7e-05 47.4 %
:HMM:PFM   4->60 PF06686 * SpoIIIAC 7.6e-18 33.3 57/58  
:HMM:PFM   72->128 PF06686 * SpoIIIAC 1.4e-23 54.4 57/58  
:BLT:SWISS 1->133 SP3AD_BACSU 2e-68 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14371.1 GT:GENE spoIIIAD GT:PRODUCT stage III sporulation protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2535544..2535945) GB:FROM 2535544 GB:TO 2535945 GB:DIRECTION - GB:GENE spoIIIAD GB:PRODUCT stage III sporulation protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15028710, 15849754, 16850406, 1766372; Product type cp: cell process GB:PROTEIN_ID CAB14371.1 GB:DB_XREF GOA:P49781 InterPro:IPR014211 SubtiList:BG11411 UniProtKB/Swiss-Prot:P49781 GB:GENE:GENE spoIIIAD LENGTH 133 SQ:AASEQ MQIDIVQIVGLGLIATFLSLIVKEQKPTFAFLIVVFAGCAIFLYLVDQIYDIIRMIEKIAINANVNMVYVETILKIIGIAYIAEFGAQLTKDAGQGAIASKIELAGKILILVMAVPILTVIIETILGLIPSMS GT:EXON 1|1-133:0| SW:ID SP3AD_BACSU SW:DE RecName: Full=Stage III sporulation protein AD; SW:GN Name=spoIIIAD; OrderedLocusNames=BSU24400; SW:KW Cell membrane; Complete proteome; Membrane; Sporulation;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->133|SP3AD_BACSU|2e-68|100.0|133/133| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 2->24| TM:REGION 33->55| TM:REGION 67->89| TM:REGION 104->126| RP:PFM:NREP 1 RP:PFM:REP 73->129|PF06686|7e-05|47.4|57/58|SpoIIIAC| HM:PFM:NREP 2 HM:PFM:REP 4->60|PF06686|7.6e-18|33.3|57/58|SpoIIIAC| HM:PFM:REP 72->128|PF06686|1.4e-23|54.4|57/58|SpoIIIAC| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------111111111111111111111111-1--1-1111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 133-134| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //