[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spoVB
DDBJ      :spoVB        putative putative translocase with flippase function for teichoic acid synthesis; involved in spore cortex synthesis (stage V sporulation)
Swiss-Prot:SP5B_BACSU   RecName: Full=Stage V sporulation protein B;AltName: Full=Stage III sporulation protein F;

Homologs  Archaea  3/68 : Bacteria  166/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:518 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->308 PF01943 * Polysacc_synt 1e-19 35.8 %
:HMM:PFM   7->307 PF01943 * Polysacc_synt 3.2e-67 31.4 271/273  
:HMM:PFM   267->399 PF01554 * MatE 4.3e-08 16.7 126/162  
:HMM:PFM   482->505 PF01034 * Syndecan 0.00023 45.8 24/328  
:BLT:SWISS 1->505 SP5B_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14727.1 GT:GENE spoVB GT:PRODUCT putative putative translocase with flippase function for teichoic acid synthesis; involved in spore cortex synthesis (stage V sporulation) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2829564..2831120 GB:FROM 2829564 GB:TO 2831120 GB:DIRECTION + GB:GENE spoVB GB:PRODUCT putative putative translocase with flippase function for teichoic acid synthesis; involved in spore cortex synthesis (stage V sporulation) GB:FUNCTION 16.13: Shape GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15292147, 15849754, 16850406, 1744050; Product type pt: putative transporter GB:PROTEIN_ID CAB14727.1 GB:DB_XREF GOA:Q00758 InterPro:IPR014249 SubtiList:BG10778 UniProtKB/Swiss-Prot:Q00758 GB:GENE:GENE spoVB LENGTH 518 SQ:AASEQ MAKQTFLKGTLILIAAGMVTRMLGFVNRVVIARFIGEEGVGLYMMAAPTFFLATTLTQFGLPVAISKLVAEASARGDHQKTKNILVMSLTITGVLSLIFTPLFLFFAPVMAETMLTDKRTLYPLLAITPVVPIIAISSVLRGYFQGKQNMNPLAMSQVLEQVVRISLVAVCTTIFLPYGIEYAAAGAMLSSVAGELASLLYLFVCFKYKKTIKIRKHFLQSIKNGKQTFTQLMSVSLPTTGSRFIGNLSWFFEPIVVAQSLAIAGVATVAATKQYGELTGFAMTLLTLPSFITYSLSTALVPAISEGMEQKKLQVVEYRLEQAMRLCLLSGGISVVILFVFADELMRVMYGSSGAAVFIKVMAPFFLLYYFQGPLQAVLQALNLAGAAMMNSLIGALVKTGLIFVLATRPSLGIMGAALAIVTGMVLVTLLHAATVSKVLPISIKIKEYALSFAVIVICGFISSAIKQYISFGASEAVNLAGWIAASAAIYMILLLVFRLIKKDELRRIPIIGRLIIR GT:EXON 1|1-518:0| SW:ID SP5B_BACSU SW:DE RecName: Full=Stage V sporulation protein B;AltName: Full=Stage III sporulation protein F; SW:GN Name=spoVB; Synonyms=spoIIIF; OrderedLocusNames=BSU27670; SW:KW Cell membrane; Complete proteome; Membrane; Sporulation;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->505|SP5B_BACSU|0.0|100.0|505/518| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 13 TM:REGION 10->32| TM:REGION 46->68| TM:REGION 88->110| TM:REGION 120->142| TM:REGION 160->182| TM:REGION 186->207| TM:REGION 248->270| TM:REGION 280->302| TM:REGION 322->344| TM:REGION 369->391| TM:REGION 418->440| TM:REGION 447->469| TM:REGION 476->498| SEG 46->61|aaptfflattltqfgl| SEG 506->517|lrripiigrlii| RP:PFM:NREP 1 RP:PFM:REP 6->308|PF01943|1e-19|35.8|274/274|Polysacc_synt| HM:PFM:NREP 3 HM:PFM:REP 7->307|PF01943|3.2e-67|31.4|271/273|Polysacc_synt| HM:PFM:REP 267->399|PF01554|4.3e-08|16.7|126/162|MatE| HM:PFM:REP 482->505|PF01034|0.00023|45.8|24/328|Syndecan| GO:PFM:NREP 2 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF01943|IPR002797| GO:PFM GO:0016020|"GO:membrane"|PF01943|IPR002797| OP:NHOMO 370 OP:NHOMOORG 170 OP:PATTERN --------------------------------12-------------------1-------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------344666665665666556444443666222532223333333211111111111111-1111321--1--12111--1-12--1-1111111111111111111111111111111111111111111111123333333333333322333333232--3222111211122111112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 212-226| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcc //