[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spoVFB
DDBJ      :spoVFB       spore dipicolinate synthase subunit B
Swiss-Prot:SP5FB_BACSU  RecName: Full=Dipicolinate synthase, B chain;

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.34.1
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->184 1e20A PDBj 2e-19 20.3 %
:RPS:SCOP  1->172 1p3y1  c.34.1.1 * 2e-26 16.9 %
:HMM:SCOP  7->196 1sbzA_ c.34.1.1 * 6e-30 26.8 %
:HMM:PFM   7->128 PF02441 * Flavoprotein 3.2e-19 25.4 118/122  
:BLT:SWISS 1->200 SP5FB_BACSU e-114 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13547.1 GT:GENE spoVFB GT:PRODUCT spore dipicolinate synthase subunit B GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1745263..1745865 GB:FROM 1745263 GB:TO 1745865 GB:DIRECTION + GB:GENE spoVFB GB:PRODUCT spore dipicolinate synthase subunit B GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16707666, 8098035; Product type e: enzyme GB:PROTEIN_ID CAB13547.1 GB:DB_XREF GOA:Q04810 InterPro:IPR003382 SubtiList:BG10782 UniProtKB/Swiss-Prot:Q04810 GB:GENE:GENE spoVFB LENGTH 200 SQ:AASEQ MSSLKGKRIGFGLTGSHCTYEAVFPQIEELVNEGAEVRPVVTFNVKSTNTRFGEGAEWVKKIEDLTGYEAIDSIVKAEPLGPKLPLDCMVIAPLTGNSMSKLANAMTDSPVLMAAKATIRNNRPVVLGISTNDALGLNGTNLMRLMSTKNIFFIPFGQDDPFKKPNSMVAKMDLLPQTIEKALMHQQLQPILVENYQGND GT:EXON 1|1-200:0| SW:ID SP5FB_BACSU SW:DE RecName: Full=Dipicolinate synthase, B chain; SW:GN Name=spoVFB; Synonyms=dpaB; OrderedLocusNames=BSU16740; SW:KW Amino-acid biosynthesis; Complete proteome;Diaminopimelate biosynthesis; Lysine biosynthesis; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->200|SP5FB_BACSU|e-114|100.0|200/200| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| RP:PDB:NREP 1 RP:PDB:REP 5->184|1e20A|2e-19|20.3|172/185| HM:PFM:NREP 1 HM:PFM:REP 7->128|PF02441|3.2e-19|25.4|118/122|Flavoprotein| RP:SCP:NREP 1 RP:SCP:REP 1->172|1p3y1|2e-26|16.9|160/171|c.34.1.1| HM:SCP:REP 7->196|1sbzA_|6e-30|26.8|179/0|c.34.1.1|1/1|Homo-oligomeric flavin-containing Cys decarboxylases, HFCD| OP:NHOMO 55 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111112111111111111111--------11------------------------------------------------------------------------------------------1--------------11------1-1--1-1111111111111---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 90.0 SQ:SECSTR ####cccEEEEEEcccGGGGGHH#HHHHHHHHTTcEEEEEEcTTHHcGGGccTTcEEEcTTHHHHHcccTTcccHHHHHHHHcTTEcEEEEEEEcHHHHHHHHTTccccHHHHHHHTccTHTccEEEEEcccHHHHHcHHHHHHHHHHHTcEEcccccTTcTTcccccccccHccHHHHHHHHHH############### DISOP:02AL 1-4, 199-200| PSIPRED cccccccEEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHcccccccEEEEccccHHHHHHHHHHHcccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHHHHHHcccccccEEEEcccccc //