[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spoVK
DDBJ      :spoVK        mother cell sporulation ATPase
Swiss-Prot:SP5K_BACSU   RecName: Full=Stage V sporulation protein K;

Homologs  Archaea  2/68 : Bacteria  150/915 : Eukaryota  64/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:322 amino acids
:PSIPRED
:BLT:PDB   58->229 2r62A PDBj 5e-09 29.9 %
:RPS:PDB   59->253 2dhrD PDBj 5e-16 24.3 %
:RPS:SCOP  58->286 1sxjA2  c.37.1.20 * 5e-16 15.3 %
:HMM:SCOP  36->317 1qvrA2 c.37.1.20 * 1.6e-37 24.0 %
:RPS:PFM   95->219 PF00004 * AAA 6e-12 38.1 %
:HMM:PFM   95->226 PF00004 * AAA 4.2e-23 26.4 121/130  
:HMM:PFM   46->135 PF05673 * DUF815 0.00099 29.3 75/250  
:BLT:SWISS 1->322 SP5K_BACSU e-165 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13626.2 GT:GENE spoVK GT:PRODUCT mother cell sporulation ATPase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1874203..1875171 GB:FROM 1874203 GB:TO 1875171 GB:DIRECTION + GB:GENE spoVK GB:PRODUCT mother cell sporulation ATPase GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 8464402; Product type cp: cell process GB:PROTEIN_ID CAB13626.2 GB:DB_XREF GOA:P27643 InterPro:IPR014232 SubtiList:BG11039 UniProtKB/Swiss-Prot:P27643 GB:GENE:GENE spoVK LENGTH 322 SQ:AASEQ MLERAVTYKNNGQINIILNGQKQVLTNAEAEAEYQAALQKNEAKHGILKEIEKEMSALVGMEEMKRNIKEIYAWIFVNQKRAEQGLKVGKQALHMMFKGNPGTGKTTVARLIGKLFFEMNVLSKGHLIEAERADLVGEYIGHTAQKTRDLIKKSLGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHEFILILAGYSREMDHFLSLNPGLQSRFPISIDFPDYSVTQLMEIAKRMIDEREYQLSQEAEWKLKDYLMTVKSTTSPIKFSNGRFVRNVIEKSIRAQAMRLLMGDQYLKSDLMTIKSQDLSIKEEASGSA GT:EXON 1|1-322:0| SW:ID SP5K_BACSU SW:DE RecName: Full=Stage V sporulation protein K; SW:GN Name=spoVK; Synonyms=spoVJ; OrderedLocusNames=BSU17420; SW:KW ATP-binding; Complete proteome; Nucleotide-binding; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->322|SP5K_BACSU|e-165|100.0|322/322| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| SEG 9->23|knngqiniilngqkq| SEG 28->37|aeaeaeyqaa| BL:PDB:NREP 1 BL:PDB:REP 58->229|2r62A|5e-09|29.9|157/249| RP:PDB:NREP 1 RP:PDB:REP 59->253|2dhrD|5e-16|24.3|181/445| RP:PFM:NREP 1 RP:PFM:REP 95->219|PF00004|6e-12|38.1|113/123|AAA| HM:PFM:NREP 2 HM:PFM:REP 95->226|PF00004|4.2e-23|26.4|121/130|AAA| HM:PFM:REP 46->135|PF05673|0.00099|29.3|75/250|DUF815| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF00004|IPR003959| RP:SCP:NREP 1 RP:SCP:REP 58->286|1sxjA2|5e-16|15.3|215/249|c.37.1.20| HM:SCP:REP 36->317|1qvrA2|1.6e-37|24.0|254/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 362 OP:NHOMOORG 217 OP:PATTERN ----------------------------1-1------------------------------------- --------------13344-43333244444223241----3--11------111-----11----13231----------3----------------------------------------------------------------12--11-----11111-----11-1-1-----1------------11111111-2111111212211111121111111------21------------------------------1-----1-2--------------1-------------------------------------1-1------1-1-------1-1----112-1-1211221111111------1---------1112221-11111--------------2----21-------------11-1-----11111-----------3---1-1-------------------------------------------------------1--------11-2-------3------11-------------------1-------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-- ------11-------111-11123331------21--111111---323332231-221111---------------------------2211111------------G12--------------------------------------------------------------5-22-1A------1221113331125 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- PSIPRED ccccHHHccccccEEEEEccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHcHHHHHHccccccccccEEEEEccccccHHHHHHHHHHHHHHcHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHccccccHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHccHHHHHcccEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHccccc //