[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : spoVS
DDBJ      :spoVS        regulator required for dehydratation of the spore core and assembly of the coat (stage V sporulation)
Swiss-Prot:SP5S_BACSU   RecName: Full=Stage V sporulation protein S;

Homologs  Archaea  0/68 : Bacteria  106/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->84 2ek0A PDBj 4e-20 48.8 %
:RPS:PDB   1->86 2ek0A PDBj 5e-28 47.7 %
:RPS:PFM   2->84 PF04232 * SpoVS 2e-23 73.5 %
:HMM:PFM   1->86 PF04232 * SpoVS 4.9e-48 76.7 86/86  
:BLT:SWISS 1->86 SP5S_BACSU 5e-35 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13571.1 GT:GENE spoVS GT:PRODUCT regulator required for dehydratation of the spore core and assembly of the coat (stage V sporulation) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1769935..1770195 GB:FROM 1769935 GB:TO 1770195 GB:DIRECTION + GB:GENE spoVS GB:PRODUCT regulator required for dehydratation of the spore core and assembly of the coat (stage V sporulation) GB:FUNCTION 16.13: Shape 16.3: Control 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16428420, 7559352; Product type r: regulator GB:PROTEIN_ID CAB13571.1 GB:DB_XREF GOA:P45693 InterPro:IPR007347 SubtiList:BG11245 UniProtKB/Swiss-Prot:P45693 GB:GENE:GENE spoVS LENGTH 86 SQ:AASEQ MEILKVSAKSSPNSVAGALAGVLRERGAAEIQAIGAGALNQAVKAVAIARGFVAPSGVDLICIPAFTDIQIDGEERTAIKLIVEPR GT:EXON 1|1-86:0| SW:ID SP5S_BACSU SW:DE RecName: Full=Stage V sporulation protein S; SW:GN Name=spoVS; OrderedLocusNames=BSU16980; SW:KW Cell cycle; Cell division; Complete proteome; Septation; Sporulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->86|SP5S_BACSU|5e-35|100.0|86/100| GO:SWS:NREP 4 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| SEG 27->38|gaaeiqaigaga| BL:PDB:NREP 1 BL:PDB:REP 1->84|2ek0A|4e-20|48.8|84/90| RP:PDB:NREP 1 RP:PDB:REP 1->86|2ek0A|5e-28|47.7|86/90| RP:PFM:NREP 1 RP:PFM:REP 2->84|PF04232|2e-23|73.5|83/86|SpoVS| HM:PFM:NREP 1 HM:PFM:REP 1->86|PF04232|4.9e-48|76.7|86/86|SpoVS| OP:NHOMO 151 OP:NHOMOORG 106 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111------------------------------------------------------11111---11-------------------------------------1111111-1112222222212222221111112221111111------11------------------------------------------------------------------------------------------21121111111111111111111--2--2--21111111231222321---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2222232333--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 100.0 SQ:SECSTR ccEEEEcTTccHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEEEETTEEEEEEEEEEEEE DISOP:02AL 6-7| PSIPRED ccEEEEEccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHEEEEEEcccccEEEEcccEEEEEEcccEEEEEEEEEEcc //