[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : srfAD
DDBJ      :srfAD        surfactin synthetase
Swiss-Prot:SRFAD_BACSU  RecName: Full=Surfactin synthetase thioesterase subunit;         EC=3.1.2.-;AltName: Full=Cold shock protein CSI16;

Homologs  Archaea  0/68 : Bacteria  180/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:242 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->242 2k2qB PDBj e-143 100.0 %
:RPS:PDB   9->237 3bf8A PDBj 2e-14 11.8 %
:RPS:SCOP  11->237 1jmkC  c.69.1.22 * 1e-28 19.4 %
:HMM:SCOP  10->235 1xktA_ c.69.1.22 * 8.1e-46 29.0 %
:RPS:PFM   16->222 PF00975 * Thioesterase 8e-29 33.7 %
:HMM:PFM   15->231 PF00975 * Thioesterase 2.4e-55 33.8 213/229  
:BLT:SWISS 1->242 SRFAD_BACSU e-142 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12146.1 GT:GENE srfAD GT:PRODUCT surfactin synthetase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 402388..403116 GB:FROM 402388 GB:TO 403116 GB:DIRECTION + GB:GENE srfAD GB:PRODUCT surfactin synthetase GB:FUNCTION 16.5: Explore 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16166527, 16553878, 17227471; Product type e: enzyme GB:PROTEIN_ID CAB12146.1 GB:DB_XREF GOA:Q08788 InterPro:IPR001031 PDB:2K2Q SubtiList:BG10171 UniProtKB/Swiss-Prot:Q08788 GB:GENE:GENE srfAD LENGTH 242 SQ:AASEQ MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHGTNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGIFPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSDYRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPIIQP GT:EXON 1|1-242:0| SW:ID SRFAD_BACSU SW:DE RecName: Full=Surfactin synthetase thioesterase subunit; EC=3.1.2.-;AltName: Full=Cold shock protein CSI16; SW:GN Name=srfAD; Synonyms=srfA4; OrderedLocusNames=BSU03520; SW:KW 3D-structure; Antibiotic biosynthesis; Complete proteome; Cytoplasm;Direct protein sequencing; Hydrolase; Sporulation; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->242|SRFAD_BACSU|e-142|100.0|242/242| GO:SWS:NREP 5 GO:SWS GO:0017000|"GO:antibiotic biosynthetic process"|Antibiotic biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0006950|"GO:response to stress"|Stress response| BL:PDB:NREP 1 BL:PDB:REP 1->242|2k2qB|e-143|100.0|242/242| RP:PDB:NREP 1 RP:PDB:REP 9->237|3bf8A|2e-14|11.8|229/255| RP:PFM:NREP 1 RP:PFM:REP 16->222|PF00975|8e-29|33.7|205/219|Thioesterase| HM:PFM:NREP 1 HM:PFM:REP 15->231|PF00975|2.4e-55|33.8|213/229|Thioesterase| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00975|IPR001031| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF00975|IPR001031| RP:SCP:NREP 1 RP:SCP:REP 11->237|1jmkC|1e-28|19.4|201/222|c.69.1.22| HM:SCP:REP 10->235|1xktA_|8.1e-46|29.0|214/0|c.69.1.22|1/1|alpha/beta-Hydrolases| OP:NHOMO 372 OP:NHOMOORG 207 OP:PATTERN -------------------------------------------------------------------- 1-1-3---------41222-22113122222231112-22-411-----1----------22--2168271------------------------------1---2--------------------------------------4-121-11--------------42152----------------------2-----1-1--1-11--11121--2---1---------2----------------------------------------------------1--11-------------------------------------11----1-----2-33------11------111------------------------------2----2-----------------2-1----1---111---------2--------------------------1------------------------------------------11212342211----66661711-1-1-----1-----1---12------------------1----------11-------------------31----------------------------------2----------1--------------------------3-1-------2-221---------1-11-11--------1--211----------------1---------122222111121-----1---------3-1---------------11121-1---1345452311-1111-321-------------1-----1---------------------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------4221112---1-1-21-2-322-21111-1----------2--1-1--1----11---------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 100.0 SQ:SECSTR ccHcEEEEcccccccEEEEccTTccTTTTHHHHHHHTTTccEEEEccTTcTTccccccccHHHHHHHHHHHHHHHTcccEEEEEETHHHHHHHHHHHHcGGGEEEEEEEccccccccccccccccHHHHHHHHTTTcccHHHHHHHHTTEETTEEcccHHHHHHTHHHHHcccccccccccEEEEccTTccTTGGGHHHHHHHcTTEEEcccTccccHHHHcHHHHHHHHHHHHHTcccccc DISOP:02AL 241-242| PSIPRED ccccccccccccccEEEEEccccccHHHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccHHHHHHHHHccccEEEEEcccEEEEcccHHHHHHHHHHHHHHHccccc //