[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : sspL
DDBJ      :sspL         small acid-soluble spore protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->40 PF05790 * C2-set 0.00042 41.7 24/80  
:BLT:SWISS 1->42 SSPL_BACSU 3e-21 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAE01458.1 GT:GENE sspL GT:PRODUCT small acid-soluble spore protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2310859..2310987 GB:FROM 2310859 GB:TO 2310987 GB:DIRECTION + GB:GENE sspL GB:PRODUCT small acid-soluble spore protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10333516; Product type cp: cell process GB:PROTEIN_ID CAE01458.1 GB:DB_XREF GOA:Q7WY66 InterPro:IPR017526 SubtiList:BG14176 UniProtKB/Swiss-Prot:Q7WY66 GB:GENE:GENE sspL LENGTH 42 SQ:AASEQ MKKKDKGRLTGGVTPQGDLEGNTHNDPKTELEERAKKSNTKR GT:EXON 1|1-42:0| BL:SWS:NREP 1 BL:SWS:REP 1->42|SSPL_BACSU|3e-21|100.0|42/100| HM:PFM:NREP 1 HM:PFM:REP 17->40|PF05790|0.00042|41.7|24/80|C2-set| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-10, 24-42| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHHccccc //