[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ssuA
DDBJ      :ssuA         aliphatic sulfonate ABC transporter (binding lipoprotein)
Swiss-Prot:SSUA_BACSU   RecName: Full=Putative aliphatic sulfonates-binding protein;Flags: Precursor;

Homologs  Archaea  13/68 : Bacteria  336/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.19c.94.1
:332 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->296 3e4rA PDBj 2e-33 32.8 %
:RPS:PDB   33->326 2de3B PDBj 8e-32 18.0 %
:RPS:SCOP  17->298 1dioA  c.1.19.3 * 4e-26 9.0 %
:HMM:SCOP  31->255 1xs5A_ c.94.1.1 * 1.5e-50 31.3 %
:RPS:PFM   56->246 PF09084 * NMT1 1e-24 37.0 %
:HMM:PFM   41->254 PF09084 * NMT1 1.7e-27 27.9 208/216  
:BLT:SWISS 1->332 SSUA_BACSU e-175 100.0 %
:TM
:REPEAT 2|71->123|125->168
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12712.1 GT:GENE ssuA GT:PRODUCT aliphatic sulfonate ABC transporter (binding lipoprotein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 962179..963177 GB:FROM 962179 GB:TO 963177 GB:DIRECTION + GB:GENE ssuA GB:PRODUCT aliphatic sulfonate ABC transporter (binding lipoprotein) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 11390694, 16513748, 16885442, 9782504; Product type f: factor GB:PROTEIN_ID CAB12712.1 GB:DB_XREF GOA:P40400 InterPro:IPR001638 SubtiList:BG10656 UniProtKB/Swiss-Prot:P40400 GB:GENE:GENE ssuA LENGTH 332 SQ:AASEQ MKKGLIVLVAVIFLLAGCGANGASGDHKQLKEIRIGIQQSLSPLLIAKEKGWFEDAFEKEGIKVKWVEFQSGPPQFEGLAADKLDFSQVGNSPVIAGQAAGIDFKEIGLSQDGLKANGILVNQNSGIQDVKGLKGKKIAVAKGSSGFDFLYKALDQVGLSANDVTIIQLQPDEAASAFENGSVDAWSIWEPYLSLETMKHGAKILVNGESTDLYSPGFTLVRTKFSEEHPDEVVRFLKVFNKAVVWQKEHLDEAADLYSDIKDLDKKVVENVLKNTEPLNEIISDDIVKAQQETADFQFRTKAIDKKIDVKDVVDNTFIKKALEEHSSGGDQ GT:EXON 1|1-332:0| SW:ID SSUA_BACSU SW:DE RecName: Full=Putative aliphatic sulfonates-binding protein;Flags: Precursor; SW:GN Name=ssuA; Synonyms=ygbA, yzeA; OrderedLocusNames=BSU08840; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->332|SSUA_BACSU|e-175|100.0|332/332| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 4->21| NREPEAT 1 REPEAT 2|71->123|125->168| SEG 5->16|livlvaviflla| SEG 304->315|idkkidvkdvvd| BL:PDB:NREP 1 BL:PDB:REP 32->296|3e4rA|2e-33|32.8|262/291| RP:PDB:NREP 1 RP:PDB:REP 33->326|2de3B|8e-32|18.0|289/347| RP:PFM:NREP 1 RP:PFM:REP 56->246|PF09084|1e-24|37.0|189/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 41->254|PF09084|1.7e-27|27.9|208/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 17->298|1dioA|4e-26|9.0|267/551|c.1.19.3| HM:SCP:REP 31->255|1xs5A_|1.5e-50|31.3|217/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 958 OP:NHOMOORG 350 OP:PATTERN --------------------------------11---------12-12111111---1---------- -1--3---111---332----1---6------23334341-11221---11-113--1---1---114251-111----------1--------------------------------------1-------------------1-------1----1-1--1---16-5-------------121-----1-11111112111211125111-111-1-2----------13------------------------11---------21----1------------11-------------------------11---111-1--12-----------211-----12--1----11-111---2----------1--------A686B-217-13211111111112-9848837A-3--85551-22314464---112-4-11--11111111----13-------------------------------1--1-1274546CCBC5322219987333312B5C6461--552-21--351283-5--3121-----------111-21--1--1-1--1-142-112-------8---1-------------------------1---1-----1------1----------1-------1------3233-222222221222-222222222222222222256544-------------------22222212--122122212222----------------11---------------6665624---F298493689477341776---------1----------------2-------------14------------------------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 93.4 SQ:SECSTR ################HHHHHHHHHTTcEEccEEEEEEEcccHHHHHHHTTHHHHHGGHTTEEEEEccGGGTTHHHHcccTTEEEEEccHHHHHHHHTTcTTcEEEEEEEEEccccEEEEEcTTcccccGGGGTTcEEEEcHHHHHHHHHHHHHHHTTccGGGcEEEEcccTTTcHHHHHTcccEEEEEHHHHHHHHTTTcEEcccGGGcGGGcEEEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTccHHHHHHHHcTTGGccccccHHHHHHHHHHHHHHHHTTcccccccHHHHccHHHHHHHHHHc###### DISOP:02AL 23-26, 327-332| PSIPRED ccHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEEEEEEcccccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEEEcccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHcccccc //