[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ssuD
DDBJ      :ssuD         FMNH2-dependent aliphatic sulfonate monooxygenase
Swiss-Prot:SSUD_BACSU   RecName: Full=Alkanesulfonate monooxygenase;         EC=1.14.14.5;AltName: Full=FMNH2-dependent aliphatic sulfonate monooxygenase;

Homologs  Archaea  12/68 : Bacteria  283/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:376 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->347 1nqkA PDBj e-130 67.0 %
:RPS:PDB   1->369 3b9oA PDBj 5e-58 27.3 %
:RPS:SCOP  1->365 1m41A  c.1.16.4 * 7e-71 63.6 %
:HMM:SCOP  1->347 1m41A_ c.1.16.4 * 6.8e-102 37.5 %
:RPS:PFM   29->321 PF00296 * Bac_luciferase 2e-38 43.0 %
:HMM:PFM   1->323 PF00296 * Bac_luciferase 2.2e-87 39.5 294/307  
:BLT:SWISS 1->376 SSUD_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12714.2 GT:GENE ssuD GT:PRODUCT FMNH2-dependent aliphatic sulfonate monooxygenase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 964027..965157 GB:FROM 964027 GB:TO 965157 GB:DIRECTION + GB:GENE ssuD GB:PRODUCT FMNH2-dependent aliphatic sulfonate monooxygenase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11390694, 16513748, 16885442, 9782504; Product type e: enzyme GB:PROTEIN_ID CAB12714.2 GB:DB_XREF GOA:P40402 HSSP:1M41 InterPro:IPR016048 SubtiList:BG10658 UniProtKB/Swiss-Prot:P40402 GB:GENE:GENE ssuD LENGTH 376 SQ:AASEQ MEILWFIPTHGDARYLGSESDGRTADHLYFKQVAQAADRLGYTGVLLPTGRSCEDPWLTASALAGETKDLKFLVAVRPGLMQPSLAARMTSTLDRISDGRLLINVVAGGDPYELAGDGLFISHDERYEATDEFLTVWRRLLQGETVSYEGKHIKVENSNLLFPPQQEPHPPIYFGGSSQAGIEAAAKHTDVYLTWGEPPEQVKEKIERVKKQAAKEGRSVRFGIRLHVIARETEQEAWEAAERLISHLDDDTIAKAQAALSRYDSSGQQRMAVLHQGDRTKLEISPNLWAGIGLVRGGAGTALVGDPQTIADRIAEYQALGIESFIFSGYPHLEEAYYFAELVFPLLPFENDRTRKLQNKRGEAVGNTYFVKEKNA GT:EXON 1|1-376:0| SW:ID SSUD_BACSU SW:DE RecName: Full=Alkanesulfonate monooxygenase; EC=1.14.14.5;AltName: Full=FMNH2-dependent aliphatic sulfonate monooxygenase; SW:GN Name=ssuD; Synonyms=ygcA, yzeC; OrderedLocusNames=BSU08860; SW:KW Complete proteome; FMN; Monooxygenase; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->376|SSUD_BACSU|0.0|100.0|376/376| GO:SWS:NREP 3 GO:SWS GO:0004497|"GO:monooxygenase activity"|Monooxygenase| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 1->347|1nqkA|e-130|67.0|330/345| RP:PDB:NREP 1 RP:PDB:REP 1->369|3b9oA|5e-58|27.3|355/433| RP:PFM:NREP 1 RP:PFM:REP 29->321|PF00296|2e-38|43.0|263/296|Bac_luciferase| HM:PFM:NREP 1 HM:PFM:REP 1->323|PF00296|2.2e-87|39.5|294/307|Bac_luciferase| RP:SCP:NREP 1 RP:SCP:REP 1->365|1m41A|7e-71|63.6|327/328|c.1.16.4| HM:SCP:REP 1->347|1m41A_|6.8e-102|37.5|347/0|c.1.16.4|1/1|Bacterial luciferase-like| OP:NHOMO 1113 OP:NHOMOORG 337 OP:PATTERN --------1111111--------1------2-----1-----------------------------11 1---C---442---9A811-17--8M1111169ABA7BE8-A19623-123-223212---11-7446-35-----------6-------------------------1-----------------------------------14------3-------------1417-------------1-------1-11111112111111113-11-21111-2121--------2---------------1---2------------------------------------------------------------------------------------------------------------------------1--322------5266G-1-1--31------------55355346181-HAAA331564114411-111----11-3-333333----3----------------------------------1A1-1---169AAA73333144334444148593322--221-12--33-24--4--525-------------1------------------------------3--------------1-----------------1---------------------------------------1121-212222222222-22222222222222222214651111-----------------2--3111---1111111-1111---------------------------------4433439---968858495826A521777------------------------112---------------------------------------------------------------------- ---------------452-53336464-------------------2233248333-124446---1--1---21-----111212------5---------1-----1-------------------------------------------------------------------------------12--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 362 STR:RPRED 96.3 SQ:SECSTR cEEEEEEEcccccccTTGGGcGGGGcHHHHHHHHHHHHHTTccEEEEEccccccccGGGHHHHHHTccccEEEEEEEcccccHHHHHHHHHHHHHHTTccEEEEEEccccHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHTccccEEccccEEcccccccccccTcccEEEEEcccHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHGGGTcGcEEEEEEEEEEcccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccGGGccTTcccccccHHccHHHHHHHHHHTcTTccccEEEEEcHHHHHHHHHHHHHHHccEEEEEcccTTHHHHHHHHHHHHHH#######HHTTccccccccccH####### DISOP:02AL 358-361, 371-376| PSIPRED cEEEEEEEccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccEEEccccEEEEccccccccEEEEEcccHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccc //