[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : tenI
DDBJ      :tenI         inhibitor of thiaminase TenA
Swiss-Prot:TENI_BACSU   RecName: Full=Regulatory protein tenI;

Homologs  Archaea  22/68 : Bacteria  229/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.1.3
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->200 1yadB PDBj e-104 100.0 %
:RPS:PDB   3->204 3ceuA PDBj 2e-13 17.4 %
:RPS:SCOP  9->200 1xi3A  c.1.3.1 * 3e-18 30.3 %
:HMM:SCOP  1->203 2tpsA_ c.1.3.1 * 4.4e-46 36.5 %
:RPS:PFM   3->177 PF02581 * TMP-TENI 5e-22 38.4 %
:HMM:PFM   4->179 PF02581 * TMP-TENI 7.9e-41 36.4 176/180  
:BLT:SWISS 1->205 TENI_BACSU e-113 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13023.1 GT:GENE tenI GT:PRODUCT inhibitor of thiaminase TenA GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1243134..1243751 GB:FROM 1243134 GB:TO 1243751 GB:DIRECTION + GB:GENE tenI GB:PRODUCT inhibitor of thiaminase TenA GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15709744, 15858269, 16356850; Product type r: regulator GB:PROTEIN_ID CAB13023.1 GB:DB_XREF GOA:P25053 InterPro:IPR003733 PDB:1YAD SubtiList:BG10792 UniProtKB/Swiss-Prot:P25053 GB:GENE:GENE tenI LENGTH 205 SQ:AASEQ MELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFETDCKKGLEGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMRYEKAL GT:EXON 1|1-205:0| SW:ID TENI_BACSU SW:DE RecName: Full=Regulatory protein tenI; SW:GN Name=tenI; OrderedLocusNames=BSU11660; SW:KW 3D-structure; Complete proteome; Repressor; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->205|TENI_BACSU|e-113|100.0|205/205| GO:SWS:NREP 2 GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 1->200|1yadB|e-104|100.0|193/193| RP:PDB:NREP 1 RP:PDB:REP 3->204|3ceuA|2e-13|17.4|184/193| RP:PFM:NREP 1 RP:PFM:REP 3->177|PF02581|5e-22|38.4|172/179|TMP-TENI| HM:PFM:NREP 1 HM:PFM:REP 4->179|PF02581|7.9e-41|36.4|176/180|TMP-TENI| GO:PFM:NREP 2 GO:PFM GO:0004789|"GO:thiamin-phosphate diphosphorylase activity"|PF02581|IPR003733| GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF02581|IPR003733| RP:SCP:NREP 1 RP:SCP:REP 9->200|1xi3A|3e-18|30.3|188/202|c.1.3.1| HM:SCP:REP 1->203|2tpsA_|4.4e-46|36.5|203/226|c.1.3.1|1/1|Thiamin phosphate synthase| OP:NHOMO 324 OP:NHOMOORG 262 OP:PATTERN -----------------1----------1--111----111--112-1--111-111---1111---- 112---------------------------------1------------------1------------------------1-221122--------------------2----------------22212222222-------1-1--1-1111------11---1111-1111111111111--------222111111111111111112212112112-121----1-211--------------1--2----------------1----------111-------12222122222--------------11---111--1122111111111112222222-2112-211-11-1-1--11111--1--2------------1------------------------1-----11---------------1------------------------1-1--------------------------------1-----------------------------------------1--------1------------------111----11-11-----1--1221221111-------2--1--111112----------1-------1--1-------------------1-------1-----------------------------------------------------------------------------------------------1111111111-----------------------------1-1-----1111---11111----------111------1----11-----1112222--1-11--------------------------------------------------1-2 ---------------------------111--1--------------------------------------------------------------1-------------------------------------------------------------------1----------------1--11-----11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 100.0 SQ:SECSTR HHEEEEccccccTTHHHHHHHHHHTTccEEEEccccccHHHHHHHHHccGGTccGGGHHHGGGGEEEcccTTHHHTTcEEEcccccccccTTcccEEEEEEccHHHHHTTGGGccEEEccccccHTccEEEcTccHHHHHHHHHTTcccTTEEEccccTTTHHHHHHTTccEEEEcHHHHTTccTTTccccHHHHHHHHHHHHHH DISOP:02AL 203-205| PSIPRED cEEEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHcccEEEEcHHcccHHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHccccEEEEEHHHHccccHHHHHHHHHHHHHHccccccc //