[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : tgl
DDBJ      :tgl          protein-glutamine gamma-glutamyltransferase (transglutaminase)
Swiss-Prot:TGL_BACSU    RecName: Full=Protein-glutamine gamma-glutamyltransferase;         EC=2.3.2.13;AltName: Full=Transglutaminase;         Short=TGase;

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:245 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->245 TGL_BACSU e-144 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15105.1 GT:GENE tgl GT:PRODUCT protein-glutamine gamma-glutamyltransferase (transglutaminase) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3212591..3213328 GB:FROM 3212591 GB:TO 3213328 GB:DIRECTION + GB:GENE tgl GB:PRODUCT protein-glutamine gamma-glutamyltransferase (transglutaminase) GB:FUNCTION 16.13: Shape 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16267299, 16751597, 16936016, 18249137, 9692191; Product type e: enzyme GB:PROTEIN_ID CAB15105.1 GB:DB_XREF GOA:P40746 SubtiList:BG10946 UniProtKB/Swiss-Prot:P40746 GB:GENE:GENE tgl LENGTH 245 SQ:AASEQ MIIVSGQLLRPQDIENWQIDQDLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAKTLHKSGAKFATFLKTYGNTTYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAIVIIYYLALIDTIGEDKFNASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQKAQWRGENVILLGEDKYFAHGLGILNGKQIIDKLNSFRKKGALQSAYLLSQATRLDVPSLFRIVR GT:EXON 1|1-245:0| SW:ID TGL_BACSU SW:DE RecName: Full=Protein-glutamine gamma-glutamyltransferase; EC=2.3.2.13;AltName: Full=Transglutaminase; Short=TGase; SW:GN Name=tgl; Synonyms=yugV, yuxF; OrderedLocusNames=BSU31270; SW:KW Acyltransferase; Complete proteome; Sporulation; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->245|TGL_BACSU|e-144|100.0|245/245| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| TM:NTM 1 TM:REGION 111->133| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11111111111111111-11----------11-----------------------------------------------------------------------------------------------1111111-1---11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cEEEccEEEcccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccEEEcccccHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccEEEEccccccccccccccEEcccEEEEcccccccccccEEEEEEEEEEcccEEEEEEEEcccHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHc //