[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : trpC
DDBJ      :trpC         indol-3-glycerol phosphate synthase
Swiss-Prot:TRPC_BACSU   RecName: Full=Indole-3-glycerol phosphate synthase;         Short=IGPS;         EC=4.1.1.48;

Homologs  Archaea  58/68 : Bacteria  731/915 : Eukaryota  118/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:249 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   29->246 1j5tA PDBj 4e-31 36.7 %
:RPS:PDB   17->235 3b5vA PDBj 2e-20 24.2 %
:RPS:SCOP  27->247 1i4nA  c.1.2.4 * 2e-69 37.6 %
:HMM:SCOP  1->251 1i4nA_ c.1.2.4 * 6e-75 48.8 %
:RPS:PFM   42->246 PF00218 * IGPS 1e-45 52.5 %
:HMM:PFM   1->246 PF00218 * IGPS 4e-89 53.9 245/255  
:BLT:SWISS 15->249 TRPC_BACSU e-129 100.0 %
:PROS 42->60|PS00614|IGPS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14182.3 GT:GENE trpC GT:PRODUCT indol-3-glycerol phosphate synthase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2374139..2374888) GB:FROM 2374139 GB:TO 2374888 GB:DIRECTION - GB:GENE trpC GB:PRODUCT indol-3-glycerol phosphate synthase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10714985, 12963367, 17114058, 2422155, 9383185; Product type e: enzyme GB:PROTEIN_ID CAB14182.3 GB:DB_XREF GOA:P03964 HSSP:1J5T InterPro:IPR001468 SubtiList:BG11038 UniProtKB/Swiss-Prot:P03964 GB:GENE:GENE trpC LENGTH 249 SQ:AASEQ MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASPSKGLIKEDFVPVQIAKDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIDSLQVEESRRIGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNRNLKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQRKAIHALFRE GT:EXON 1|1-249:0| SW:ID TRPC_BACSU SW:DE RecName: Full=Indole-3-glycerol phosphate synthase; Short=IGPS; EC=4.1.1.48; SW:GN Name=trpC; OrderedLocusNames=BSU22660; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Decarboxylase; Lyase; Tryptophan biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 15->249|TRPC_BACSU|e-129|100.0|235/249| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016831|"GO:carboxy-lyase activity"|Decarboxylase| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0000162|"GO:tryptophan biosynthetic process"|Tryptophan biosynthesis| PROS 42->60|PS00614|IGPS|PDOC00536| SEG 3->14|ekiikqkkeevk| BL:PDB:NREP 1 BL:PDB:REP 29->246|1j5tA|4e-31|36.7|215/233| RP:PDB:NREP 1 RP:PDB:REP 17->235|3b5vA|2e-20|24.2|215/247| RP:PFM:NREP 1 RP:PFM:REP 42->246|PF00218|1e-45|52.5|204/253|IGPS| HM:PFM:NREP 1 HM:PFM:REP 1->246|PF00218|4e-89|53.9|245/255|IGPS| RP:SCP:NREP 1 RP:SCP:REP 27->247|1i4nA|2e-69|37.6|218/251|c.1.2.4| HM:SCP:REP 1->251|1i4nA_|6e-75|48.8|248/0|c.1.2.4|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 951 OP:NHOMOORG 907 OP:PATTERN 11-1--1111111111-111111111111111111111111111111111111111--1--111--11 111-122111111111111-11111111111111111111111111111111111111--1111111121111111-1----111111111111---111-111111111--------11-----11111111111111111111111211111111111111111123311111111111111111111-11111111111-111111111111111111111111111111-1111111111111111111----11-----11--11----1-111-------11111111111111-------------1--111----11-11----------1-11----1-1--11111112111--111111--11111111-----221111111111111111111111-11111111111-1111111111111211111111111111111111111111111-----------------------------11111111111111211111111111111111111111111112111111111111111111111111111111111-11111111111111111111111111111211111111111-1111111111111111111111111111111111111111111111--1111111-1111111111111-111111-1111111111111111111111111111111111111111111111111111-11111111111111-111-11111111111111111-11111-111111111111111111111111111111211111111111111111111111111111111111111111-111111--------------------------------------1--1-111112 ------1-----1111111-111121111111111111-1111111111111111111111111111111111111111111111111-13112121111111111-12------------------------------------------------------1------------11191111113421231111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 93.6 SQ:SECSTR ################ccccccccccccHHHHHHHHHTcccEEEEEccccTTccccccccEEHHHHHHHHTTTccEEEEEcccTTTcccHHHHHHHHTTccccEEEEccccTHHHHHHHHHTccEEEEETTTccHHHHHHHHHHHHHTTcccEEEEccHHHHHHHHHTTccEEEEEEcccTTTcccccTTHHHHHHHccTTcEEEEEcccccHHHHHHHHHTTccEEEEcHHHHHcccccEEEHHHHHH PSIPRED cHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccEEEEEEEccccccccccccccHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHccccEEEHHcccHHHHHHHHHHcccEEEEEHHHccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHccccEEEEcHHHHccccHHHHHHHHHcc //