[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : udk
DDBJ      :udk          uridine kinase
Swiss-Prot:URK_BACSU    RecName: Full=Uridine kinase;         EC=2.7.1.48;AltName: Full=Uridine monophosphokinase;AltName: Full=Cytidine monophosphokinase;

Homologs  Archaea  6/68 : Bacteria  394/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->205 1udwB PDBj 9e-39 39.4 %
:RPS:PDB   18->208 1a7jA PDBj 3e-23 12.8 %
:RPS:SCOP  18->159 1rz3A  c.37.1.6 * 1e-29 20.6 %
:RPS:SCOP  169->197 1esmA  c.37.1.6 * 6e-04 20.7 %
:HMM:SCOP  3->199 1esmA_ c.37.1.6 * 2.8e-51 35.7 %
:RPS:PFM   18->185 PF00485 * PRK 6e-32 47.3 %
:HMM:PFM   7->192 PF00485 * PRK 4e-47 31.9 185/194  
:BLT:SWISS 1->211 URK_BACSU e-106 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14675.1 GT:GENE udk GT:PRODUCT uridine kinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2792218..2792853) GB:FROM 2792218 GB:TO 2792853 GB:DIRECTION - GB:GENE udk GB:PRODUCT uridine kinase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 2b: Function of strongly homologous gene; PubMedId: 6208029; Product type e: enzyme GB:PROTEIN_ID CAB14675.1 GB:DB_XREF GOA:O32033 InterPro:IPR000764 SubtiList:BG12696 UniProtKB/Swiss-Prot:O32033 GB:GENE:GENE udk LENGTH 211 SQ:AASEQ MGKNPVVIGIAGGSGSGKTSVTRSIYEQFKGHSILMIQQDLYYKDQSHLPFEERLNTNYDHPLAFDNDYLIEHIQDLLNYRPIEKPIYDYKLHTRSEETVHVEPKDVIILEGILVLEDKRLRDLMDIKLYVDTDADLRIIRRIMRDINERGRSIDSVIEQYVSVVRPMHNQFVEPTKRYADIIIPEGGQNHVAIDLMVTKIQTILEQNAIL GT:EXON 1|1-211:0| SW:ID URK_BACSU SW:DE RecName: Full=Uridine kinase; EC=2.7.1.48;AltName: Full=Uridine monophosphokinase;AltName: Full=Cytidine monophosphokinase; SW:GN Name=udk; OrderedLocusNames=BSU27330; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->211|URK_BACSU|e-106|100.0|211/211| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 6->17|vvigiaggsgsg| SEG 138->147|riirrimrdi| BL:PDB:NREP 1 BL:PDB:REP 18->205|1udwB|9e-39|39.4|188/209| RP:PDB:NREP 1 RP:PDB:REP 18->208|1a7jA|3e-23|12.8|188/279| RP:PFM:NREP 1 RP:PFM:REP 18->185|PF00485|6e-32|47.3|167/189|PRK| HM:PFM:NREP 1 HM:PFM:REP 7->192|PF00485|4e-47|31.9|185/194|PRK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00485|IPR006083| GO:PFM GO:0008152|"GO:metabolic process"|PF00485|IPR006083| GO:PFM GO:0016301|"GO:kinase activity"|PF00485|IPR006083| RP:SCP:NREP 2 RP:SCP:REP 18->159|1rz3A|1e-29|20.6|141/184|c.37.1.6| RP:SCP:REP 169->197|1esmA|6e-04|20.7|29/311|c.37.1.6| HM:SCP:REP 3->199|1esmA_|2.8e-51|35.7|196/311|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 895 OP:NHOMOORG 580 OP:PATTERN -------------------------111--1-------------1-1--------------------- 111-------------------------------------------------------------------------------------1111-111---111111-1111----------1111------------111-----1-21121111211------1-122221------------11111----1111111111111111111111111111111111111111111111111111111111111111211211111111111111-111111111111111111111111111111111121111111111111-11-11111111111----111111-111----------1-------1-11--------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------1--------------2---------------------------1------------------------------1111--111111111111111111111111-------------1111-111111111111-1111111111111111111111111111111111111111111111111111-111111111111----111111111--1-1111111111111111-----------------------------111111111-11111111111111------------------------11111111--1----1---1--11----1-1--11111-11-1---1-- --11321-31----2111111111111111---111-1111111---111111111111111212111121121212-2212211211-111111111111-1212-24149958832313231473438R3-5451323323321333121243343348724222622223222343a33333879A1B71211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 90.5 SQ:SECSTR #################HHHHHHHHHHHccTccEEEEEGGGGccHHHHHHHHHHTcTTccTGGGccHHHHHHHHHHHHHHcccEEcccccccccccccEEccccccEEEEEEccTTcccccGGGccEEEEEEEcHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHTGGGGGTccEEEEEEEccccccGGGccccccGGGEE### DISOP:02AL 1-2, 209-211| PSIPRED cccEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccEEEccccEEEEEcHHHHccHHHHHHccEEEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHccc //