[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ureB
DDBJ      :ureB         urease (beta subunit)
Swiss-Prot:URE2_BACSU   RecName: Full=Urease subunit beta;         EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit beta;

Homologs  Archaea  6/68 : Bacteria  316/915 : Eukaryota  89/199 : Viruses  0/175   --->[See Alignment]
b.85.3
:124 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->118 1ie7B PDBj 3e-28 49.1 %
:RPS:PDB   1->98 1ejwB PDBj 3e-39 49.0 %
:RPS:SCOP  1->98 1a5kB  b.85.3.1 * 1e-39 49.0 %
:HMM:SCOP  1->120 1e9yA1 b.85.3.1 * 7.3e-42 54.2 %
:RPS:PFM   3->98 PF00699 * Urease_beta 1e-26 58.3 %
:HMM:PFM   3->98 PF00699 * Urease_beta 8.8e-44 61.5 96/100  
:BLT:SWISS 1->124 URE2_BACSU 1e-67 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15682.1 GT:GENE ureB GT:PRODUCT urease (beta subunit) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3768420..3768794) GB:FROM 3768420 GB:TO 3768794 GB:DIRECTION - GB:GENE ureB GB:PRODUCT urease (beta subunit) GB:FUNCTION 16.11: Scavenge (Catabolism) 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12401490, 16199586, 9287005; Product type e: enzyme GB:PROTEIN_ID CAB15682.1 GB:DB_XREF GOA:P71035 HSSP:1EJX InterPro:IPR002019 SubtiList:BG11982 UniProtKB/Swiss-Prot:P71035 GB:GENE:GENE ureB LENGTH 124 SQ:AASEQ MKPGAFQIAEGTITINEGREIREVTVKNTGSRSIQVGSHFHFAEANGALLFDRELAIGMRLDVPSGTSVRFEPGEQKTVSLVEIRGRKTIRGLNGMADTFIDERGKEKTLANLKQAGWMEGVIR GT:EXON 1|1-124:0| SW:ID URE2_BACSU SW:DE RecName: Full=Urease subunit beta; EC=3.5.1.5;AltName: Full=Urea amidohydrolase subunit beta; SW:GN Name=ureB; OrderedLocusNames=BSU36650; SW:KW Complete proteome; Cytoplasm; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|URE2_BACSU|1e-67|100.0|124/124| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 3->118|1ie7B|3e-28|49.1|114/122| RP:PDB:NREP 1 RP:PDB:REP 1->98|1ejwB|3e-39|49.0|98/101| RP:PFM:NREP 1 RP:PFM:REP 3->98|PF00699|1e-26|58.3|96/100|Urease_beta| HM:PFM:NREP 1 HM:PFM:REP 3->98|PF00699|8.8e-44|61.5|96/100|Urease_beta| GO:PFM:NREP 3 GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00699|IPR002019| GO:PFM GO:0009039|"GO:urease activity"|PF00699|IPR002019| GO:PFM GO:0016151|"GO:nickel ion binding"|PF00699|IPR002019| RP:SCP:NREP 1 RP:SCP:REP 1->98|1a5kB|1e-39|49.0|98/101|b.85.3.1| HM:SCP:REP 1->120|1e9yA1|7.3e-42|54.2|120/0|b.85.3.1|1/1|Urease, beta-subunit| OP:NHOMO 472 OP:NHOMOORG 411 OP:PATTERN ------1--------1--------1---1--1----------------------------------1- ----1--1111-111--11-12--1211111111111211-111--1-----11111-------1-3223-----1----------------1--------1---11-------------------------------------111-11--1----1111-1111-111111-11111-1-1--1-------1------1---------1---1----1-1----------1-11111111111111111-1---------------------------------------------------------------111---------------------------1-11-------------------1---------------11133---1111122222222222-3413313211--12-111111111111--111111111111111111----1---------------------------------------111-1111111111111211111111111111-1111111--111111-11-1-1-1---------1-11--------------------------11-1--1----------211111111---------1111---11-------1--------------11-1------1---11--12--------1---------1--------111--111--------------------------11111111111111------------1111111----111-----1111111-1-1-11111111111111212-----------11---------------------------1----------------------------------------111-----------1- -------------11111111211111111111111111111111111112112-1111111------------------------11-12111211111121221--2-2----------------------------------------------------11--------1-----8111--1-111111111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 95.2 SQ:SECSTR ccTTccccccccccccTTccEEEEEEEEcccccEEEETTccGGGccTTEEccTTTTTTEEEcccTTcEEEEcTTcEEEEEEEEccTTcEEccTTccccEEccHHHHHHHHHHHHHHTc###### PSIPRED ccccEEEEccccEEEcccccEEEEEEEEcccccEEEccEEcHHHccccccccHHHccccEEccccccEEEEccccEEEEEEEEEcccEEEEccccccccccccccHHHHHHHHHHcccEEEEEc //