[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : uxaC
DDBJ      :uxaC         galacturonate isomerase
Swiss-Prot:UXAC_BACSU   RecName: Full=Uronate isomerase;         EC=5.3.1.12;AltName: Full=Glucuronate isomerase;AltName: Full=Uronic isomerase;

Homologs  Archaea  1/68 : Bacteria  221/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:473 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->464 3iacC PDBj e-114 48.8 %
:RPS:PDB   27->464 3e2vB PDBj 3e-23 8.0 %
:RPS:SCOP  4->464 1j5sA  c.1.9.8 * 2e-75 35.7 %
:HMM:SCOP  2->465 1j5sA_ c.1.9.8 * 1.6e-182 53.8 %
:RPS:PFM   4->465 PF02614 * UxaC e-160 56.8 %
:HMM:PFM   1->468 PF02614 * UxaC 5.8e-229 60.3 468/469  
:BLT:SWISS 1->473 UXAC_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13087.1 GT:GENE uxaC GT:PRODUCT galacturonate isomerase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1300450..1301871 GB:FROM 1300450 GB:TO 1301871 GB:DIRECTION + GB:GENE uxaC GB:PRODUCT galacturonate isomerase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 9579062, 9882655; Product type e: enzyme GB:PROTEIN_ID CAB13087.1 GB:DB_XREF GOA:O34808 HSSP:1J5S InterPro:IPR003766 SubtiList:BG13204 UniProtKB/Swiss-Prot:O34808 GB:GENE:GENE uxaC LENGTH 473 SQ:AASEQ MEPFMGKNFLLKNETAVSLYHNYAKDMPIIDYHCHLSPKEIYENKTFQNITEAWLYGDHYKWRIMRANGIEETYITGDAPDEEKFMAWAKTVPMAIGNPLYNWTHLELQRFFGIYEILNEKSGSAIWKQTNKLLKGEGFGARDLIVKSNVKVVCTTDDPVDSLEYHLLLKEDKDFPVSVLPGFRPDKGLEINREGFPEWVQALEDAAAISITTYDEFLKALEKRVRFFHSAGGRVSDHAIDTMVFAETTKEEAGRIFSDRLQGTEVSCEDEKKFKTYTLQFLCGLYAELDWAMQFHINALRNTNTKMMKRLGPDTGYDSMNDEEIAKPLYKLLNSVEMKNQLPKTILYSLNPNDNYVIASMINSFQDGITPGKIQFGTAWWFNDTKDGMLDQMKALSNVGLFSRFIGMLTDSRSFLSYTRHEYFRRIVCNLIGEWVENGEVPRDMELLGSIVQGICYDNAKHYFQFQEEKANV GT:EXON 1|1-473:0| SW:ID UXAC_BACSU SW:DE RecName: Full=Uronate isomerase; EC=5.3.1.12;AltName: Full=Glucuronate isomerase;AltName: Full=Uronic isomerase; SW:GN Name=uxaC; Synonyms=yjmA; OrderedLocusNames=BSU12300; SW:KW Complete proteome; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->473|UXAC_BACSU|0.0|100.0|473/473| GO:SWS:NREP 1 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| BL:PDB:NREP 1 BL:PDB:REP 7->464|3iacC|e-114|48.8|445/453| RP:PDB:NREP 1 RP:PDB:REP 27->464|3e2vB|3e-23|8.0|361/362| RP:PFM:NREP 1 RP:PFM:REP 4->465|PF02614|e-160|56.8|461/463|UxaC| HM:PFM:NREP 1 HM:PFM:REP 1->468|PF02614|5.8e-229|60.3|468/469|UxaC| GO:PFM:NREP 2 GO:PFM GO:0006064|"GO:glucuronate catabolic process"|PF02614|IPR003766| GO:PFM GO:0008880|"GO:glucuronate isomerase activity"|PF02614|IPR003766| RP:SCP:NREP 1 RP:SCP:REP 4->464|1j5sA|2e-75|35.7|446/451|c.1.9.8| HM:SCP:REP 2->465|1j5sA_|1.6e-182|53.8|450/0|c.1.9.8|1/1|Metallo-dependent hydrolases| OP:NHOMO 238 OP:NHOMOORG 223 OP:PATTERN -----------------------------2-------------------------------------- 111----1111--------------------------------1111-1--1111--------1-11--------1------------111111-----1-1--12-1-1-----------------------------------------------------------1-----------------------1---------------111111-----1-1---------1------------------1---2------------211-----1111111111---------1-----------1------21---111111-13----------2----1--1--1--1---------------11------1111-------------------111--1-11----------11-----111-111111-1-1---111111------------------------------------------------211-------------------------------------------------------------------------------------------1-----------------------------------------2--2----1--------------------------------211111-1111111111-11111111111111111111111111-1111111111111111111-1111--111111211111-----------------11111-1-1--1-11------------1------------------------------1------1-11--11111111-------1--------------------------------------------1--11111-1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 461 STR:RPRED 97.5 SQ:SECSTR ###TTcTTTTcccHHHHHHHHHTTTTccEEEEEEcTTcGGGGTEETTEEcccccHHHHHHHHHHHHTTEEEEEEccccHHHHHHHHHHHHHHTTTcccEEEEEEcccGGGGGGGccHHHHHHHcTHHHHHHTccTTcccHHHHHHHHcTHHHHHHHHHHHHHHHHHHccTTcccccEEEEcGGcEEEEEEEEEEEEEETTcTTTccHHHHHHHHHHHHHHTHHHTccHHHHTccEEEEEEccHHHHHHcHHHHHHHHHHHHHcEEccccTTcGGGccccccEEcccTTccEEEcccccEEcHHHHHHHHHHcTTEEEEEcGGGGccHHHHHHHHTccGGGEEEcccTTcccccTTcTTHHHHHHHHHHccccccccEEEcGGGcGGGTTccccEHHHHHHHccGcccEEETTcccGGGHHHHHHHHHHHHHHTccHHHTcccccHHHHHHHHHHHHHHHHHHHc######### DISOP:02AL 1-2, 470-473| PSIPRED cccccccccccccHHHHHHHHHHHHcccEEcccccccHHHHHcccccccHHHHHccccHHHHHHHHHccccHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHccEEEEEEcccccccHHHHHHHHccccccEEEEEccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccc //