[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : uxuA
DDBJ      :uxuA         D-mannonate dehydratase
Swiss-Prot:UXUA_BACSU   RecName: Full=Mannonate dehydratase;         EC=4.2.1.8;AltName: Full=D-mannonate hydrolase;

Homologs  Archaea  6/68 : Bacteria  213/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.1.15
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->355 3banA PDBj 6e-86 49.5 %
:RPS:PDB   1->356 3banB PDBj 1e-32 46.1 %
:RPS:SCOP  3->351 1tz9A  c.1.15.6 * e-149 44.0 %
:HMM:SCOP  1->353 1tz9A_ c.1.15.6 * 9.3e-87 31.5 %
:RPS:PFM   1->348 PF03786 * UxuA 8e-92 50.3 %
:HMM:PFM   1->350 PF03786 * UxuA 1.2e-163 54.8 347/351  
:BLT:SWISS 1->359 UXUA_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13091.1 GT:GENE uxuA GT:PRODUCT D-mannonate dehydratase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1305486..1306565 GB:FROM 1305486 GB:TO 1306565 GB:DIRECTION + GB:GENE uxuA GB:PRODUCT D-mannonate dehydratase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 9579062, 9882655; Product type e: enzyme GB:PROTEIN_ID CAB13091.1 GB:DB_XREF GOA:O34346 InterPro:IPR013022 SubtiList:BG13208 UniProtKB/Swiss-Prot:O34346 GB:GENE:GENE uxuA LENGTH 359 SQ:AASEQ MNMTFRWYGRGNDTVTLEYVKQIPGVKGIVWALHQKPVGDVWEKEEIRAETEYIQSYGFHAEVVESVNVHEAIKLGNEERGRYIENYKQTIRNLAGFGVKVICYNFMPVFDWTRTDMFRPLEDGSTALFFEKAKVESLDPQELIRTVEEASDMTLPGWEPEKLARIKELFAAYRTVDEEKLWDNLSFFLQEILPVAEAYGVQMAIHPDDPPWPIFGLPRIITGEASYKKLRAISDSPSNCITLCTGSMGANPANDMVEIAKTYAGIAPFSHIRNVKIYENGDFIETSHLTKDGSINIQGVMEELHKQDYEGYVRPDHGRHLWGEQCRPGYGLYDRALGIMYLNGLWDAYEAMAKKEVGI GT:EXON 1|1-359:0| SW:ID UXUA_BACSU SW:DE RecName: Full=Mannonate dehydratase; EC=4.2.1.8;AltName: Full=D-mannonate hydrolase; SW:GN Name=uxuA; Synonyms=yjmE; OrderedLocusNames=BSU12340; SW:KW Complete proteome; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->359|UXUA_BACSU|0.0|100.0|359/359| GO:SWS:NREP 1 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 1->355|3banA|6e-86|49.5|331/349| RP:PDB:NREP 1 RP:PDB:REP 1->356|3banB|1e-32|46.1|330/349| RP:PFM:NREP 1 RP:PFM:REP 1->348|PF03786|8e-92|50.3|342/347|UxuA| HM:PFM:NREP 1 HM:PFM:REP 1->350|PF03786|1.2e-163|54.8|347/351|UxuA| GO:PFM:NREP 2 GO:PFM GO:0006064|"GO:glucuronate catabolic process"|PF03786|IPR004628| GO:PFM GO:0008927|"GO:mannonate dehydratase activity"|PF03786|IPR004628| RP:SCP:NREP 1 RP:SCP:REP 3->351|1tz9A|e-149|44.0|341/344|c.1.15.6| HM:SCP:REP 1->353|1tz9A_|9.3e-87|31.5|352/0|c.1.15.6|1/1|Xylose isomerase-like| OP:NHOMO 259 OP:NHOMOORG 222 OP:PATTERN -----------------2-----------11------------------------------111---- --3------------------------------------------1-----------------1------------------------112311-----1-2--12-4-2-----------------------------------1-------------------------------------1-------1-1---------------1222-1-----1-1---------2------------------1-1-1------------11------1111111111---------1-----------1------11---111112-13----------2----1--1--1--1------------1---1-----------------111--------11111111111------1--21--3332112111111------11111111--------1------------------------------------------------1111------111-------1--1----------------1-----------------------------------------------------1-------------------------------1--2--1-1--------------------------------211111-1111111111-11-11111111111111112221111-1111111111111111111-11111-111111111111----------------11---2-1-1111-11------------1------------------------------1------1-11-----------------1-----------------------------------------------1-111-1- ------1-----------------------------------------------------------------------------------------------------2-----------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 356 STR:RPRED 99.2 SQ:SECSTR EEEEEEcccTTTccccHHHHHTcTTccEEEEccccccTTccccHHHHHHHHHHHHHTTcEEEEEEcccccHHHHHTcTTHHHHHHHHHHHHHHHHHHTccEEEEcccccccccccccccccTTcccccEEccccHcccccccHHHHHccccccccHHHHHHHEcccccEEHHHHTccHHHHHHHHHHHHHHHHHHHHHTTcEEEEcccccccccTTcccccccHHHHHHHHHTcccTTEEEEEEHHHHTTcTTccHHHHHHHHHHTTcEEEEccEEEEETTEEEEEcccGGGccccHHHHHHHHHHTTcEEEEEcccccccTTccccGGGcHHHHHHHHHHHHHHHHHHHHHTTcc### DISOP:02AL 354-359| PSIPRED ccccEEEEccccccccHHHHHHHccccHHHHccccccccccccHHHHHHHHHHHHHcccEEEEEEcccHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHcccHHHHHcHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccEEccHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHccccEEEEEEEEEEcccccEEEcccccccccccHHHHHHHHHHccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //