[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : xkdB
DDBJ      :xkdB         conserved hypothetical protein
Swiss-Prot:XKDB_BACSU   RecName: Full=Phage-like element PBSX protein xkdB;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.4.1
:278 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   41->91 3by6C PDBj 2e-05 17.6 %
:RPS:SCOP  7->70 1c0iA1  c.4.1.2 * 3e-04 20.3 %
:RPS:SCOP  54->95 2b0lA1  a.4.5.66 * 6e-06 19.0 %
:HMM:SCOP  54->119 1stzA1 a.4.5.51 * 5e-05 24.2 %
:HMM:PFM   56->88 PF08220 * HTH_DeoR 2.4e-06 36.4 33/57  
:HMM:PFM   172->246 PF00800 * PDT 0.00022 24.6 65/182  
:BLT:SWISS 1->278 XKDB_BACSU e-163 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13109.2 GT:GENE xkdB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1322014..1322850 GB:FROM 1322014 GB:TO 1322850 GB:DIRECTION + GB:GENE xkdB GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13109.2 GB:DB_XREF GOA:P39781 SubtiList:BG10995 UniProtKB/Swiss-Prot:P39781 GB:GENE:GENE xkdB LENGTH 278 SQ:AASEQ MKNDKSYPFPTYSGLLNSEHYDKIGPALWLFLWFISSTTKEIEKDGVSWGIVLGHKPLKAREMAAVFGVSEKTVRRWLELLENHDYIKAVRAPYGLMISVKHSKKFSFRSDNTVHGSLKERPFSPQTPDTNDRTDIDKTNKYTAADDAVDHIAKRFTQLRSAQEGRTVYPSSRDYQAIARIVAIGVPVTQTIKWLEECFQAFENRRTAASETIKAFRYCSKFIEDRFFAQQAKKNAAIQHERMKKHDKTNNRTDFGRAEKRETSITGGQTGRIRRKQV GT:EXON 1|1-278:0| SW:ID XKDB_BACSU SW:DE RecName: Full=Phage-like element PBSX protein xkdB; SW:GN Name=xkdB; Synonyms=ykxB; OrderedLocusNames=BSU12520; SW:KW Complete proteome; DNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->278|XKDB_BACSU|e-163|100.0|278/100| GO:SWS:NREP 1 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| RP:PDB:NREP 1 RP:PDB:REP 41->91|3by6C|2e-05|17.6|51/120| HM:PFM:NREP 2 HM:PFM:REP 56->88|PF08220|2.4e-06|36.4|33/57|HTH_DeoR| HM:PFM:REP 172->246|PF00800|0.00022|24.6|65/182|PDT| RP:SCP:NREP 2 RP:SCP:REP 7->70|1c0iA1|3e-04|20.3|64/268|c.4.1.2| RP:SCP:REP 54->95|2b0lA1|6e-06|19.0|42/91|a.4.5.66| HM:SCP:REP 54->119|1stzA1|5e-05|24.2|66/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 20.1 SQ:SECSTR ########################################HHHHHHHTTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETccccE###################################################################################################################################################################################### PSIPRED ccccccccccHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHcccEEEEEEcccccHHHHHHHHHcccHHHHHHHHHHHHcccEEEEEEcccEEEEEEEccccEEccccccEEcccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHccccccccccccEEEccc //