[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yaaA
DDBJ      :yaaA         putative RNA binding protein
Swiss-Prot:YAAA_BACSU   RecName: Full=Uncharacterized protein yaaA;

Homologs  Archaea  0/68 : Bacteria  108/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.66.1
:71 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->63 3bbnD PDBj 3e-07 11.1 %
:RPS:SCOP  5->63 1jh3A  d.66.1.4 * 6e-09 18.6 %
:HMM:SCOP  1->70 1p9kA_ d.66.1.6 * 3.5e-16 42.9 %
:HMM:PFM   49->69 PF08142 * AARP2CN 0.00032 47.6 21/84  
:BLT:SWISS 1->71 YAAA_BACSU 2e-37 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11779.1 GT:GENE yaaA GT:PRODUCT putative RNA binding protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3206..3421 GB:FROM 3206 GB:TO 3421 GB:DIRECTION + GB:GENE yaaA GB:PRODUCT putative RNA binding protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf: putative factor GB:PROTEIN_ID CAB11779.1 GB:DB_XREF GOA:P05650 InterPro:IPR014330 SubtiList:BG10067 UniProtKB/Swiss-Prot:P05650 GB:GENE:GENE yaaA LENGTH 71 SQ:AASEQ MANPISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNDEPDNRRGRKLYVGDVVEIEGFGSFQVVN GT:EXON 1|1-71:0| SW:ID YAAA_BACSU SW:DE RecName: Full=Uncharacterized protein yaaA; SW:GN Name=yaaA; OrderedLocusNames=BSU00030; SW:KW Complete proteome; RNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->71|YAAA_BACSU|2e-37|100.0|71/100| GO:SWS:NREP 1 GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| RP:PDB:NREP 1 RP:PDB:REP 1->63|3bbnD|3e-07|11.1|63/199| HM:PFM:NREP 1 HM:PFM:REP 49->69|PF08142|0.00032|47.6|21/84|AARP2CN| RP:SCP:NREP 1 RP:SCP:REP 5->63|1jh3A|6e-09|18.6|59/99|d.66.1.4| HM:SCP:REP 1->70|1p9kA_|3.5e-16|42.9|70/79|d.66.1.6|1/1|Alpha-L RNA-binding motif| OP:NHOMO 108 OP:NHOMOORG 108 OP:PATTERN -------------------------------------------------------------------- ---------------------1--------------1111---1------------------1-1-----------------1----------------------------------------------------------------------------------------------------------1-111111111111111111111111111111111111111111-111111111111-11-11111111111-1-111111111111-------------------------------------1-------------1-----------1--1-------11-----------1--111---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 88.7 SQ:SECSTR cTTTTTTHHHHccTTTTTTTTTcccccHHHHHHHHTTcEEETTEEcccTTccccTTEEEEEcc######## DISOP:02AL 1-2| PSIPRED cccEEEEcccEEEHHHHHHHcccccccHHHHHHHHcccEEEccEEEcccccEEccccEEEEcccEEEEEEc //