[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yaaB
DDBJ      :yaaB         conserved hypothetical protein
Swiss-Prot:YAAB_BACSU   RecName: Full=Uncharacterized protein yaaB;

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:HMM:PFM   14->77 PF04952 * AstE_AspA 0.00039 17.2 64/292  
:BLT:SWISS 1->81 YAAB_BACSU 1e-42 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11781.2 GT:GENE yaaB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4567..4812 GB:FROM 4567 GB:TO 4812 GB:DIRECTION + GB:GENE yaaB GB:PRODUCT conserved hypothetical protein GB:FUNCTION 18: Unknown function GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB11781.2 GB:DB_XREF SubtiList:BG10069 UniProtKB/Swiss-Prot:P37525 GB:GENE:GENE yaaB LENGTH 81 SQ:AASEQ MYIHLGDDFVVSTRDIVGIFDFKANMSPIVEEFLKKQKHKVVPSVNGTPKSIVVTVQNIYYSPLSSSTLKKRAQFMFEIDS GT:EXON 1|1-81:0| SW:ID YAAB_BACSU SW:DE RecName: Full=Uncharacterized protein yaaB; SW:GN Name=yaaB; OrderedLocusNames=BSU00050; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->81|YAAB_BACSU|1e-42|100.0|81/100| HM:PFM:NREP 1 HM:PFM:REP 14->77|PF04952|0.00039|17.2|64/292|AstE_AspA| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------11111----------------11-------------------------------------------------------------------------------------------------------------1---------------111-11----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEcccEEEEEEEEEEEEEcccccccHHHHHHHHHcccEEEcccccEEEEEEEcccEEEEcccHHHHHHHHHccccccc //