[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yazA
DDBJ      :yazA         putative UvrC-Intron-type (URI) endonuclease
Swiss-Prot:YAZA_BACSU   RecName: Full=UPF0213 protein yazA;

Homologs  Archaea  8/68 : Bacteria  299/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.226.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->84 1zg2A PDBj 5e-22 50.0 %
:RPS:SCOP  6->83 1ln0A  d.226.1.1 * 3e-11 17.9 %
:HMM:SCOP  4->80 1mk0A_ d.226.1.1 * 2e-13 35.1 %
:RPS:PFM   9->72 PF01541 * GIY-YIG 6e-05 39.1 %
:HMM:PFM   6->76 PF01541 * GIY-YIG 2e-16 36.6 71/80  
:HMM:PFM   64->91 PF09803 * DUF2346 0.00055 28.6 28/80  
:BLT:SWISS 1->99 YAZA_BACSU 3e-56 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11811.1 GT:GENE yazA GT:PRODUCT putative UvrC-Intron-type (URI) endonuclease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 43647..43946 GB:FROM 43647 GB:TO 43946 GB:DIRECTION + GB:GENE yazA GB:PRODUCT putative UvrC-Intron-type (URI) endonuclease GB:FUNCTION 16.6: Maintain 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 11483577; Product type pe : putative enzyme GB:PROTEIN_ID CAB11811.1 GB:DB_XREF GOA:O31414 InterPro:IPR000305 SubtiList:BG12700 UniProtKB/Swiss-Prot:O31414 GB:GENE:GENE yazA LENGTH 99 SQ:AASEQ METNNHFFYVVKCKDNSWYAGYTNDLHKRVKTHNDGKGAKYTKVRRPVELIFAESFSTKREAMQAEYYFKKLTRKKKELYIEEKRNSKEAVYVKAPNEL GT:EXON 1|1-99:0| SW:ID YAZA_BACSU SW:DE RecName: Full=UPF0213 protein yazA; SW:GN Name=yazA; OrderedLocusNames=BSU00350; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->99|YAZA_BACSU|3e-56|100.0|99/99| BL:PDB:NREP 1 BL:PDB:REP 5->84|1zg2A|5e-22|50.0|80/94| RP:PFM:NREP 1 RP:PFM:REP 9->72|PF01541|6e-05|39.1|64/80|GIY-YIG| HM:PFM:NREP 2 HM:PFM:REP 6->76|PF01541|2e-16|36.6|71/80|GIY-YIG| HM:PFM:REP 64->91|PF09803|0.00055|28.6|28/80|DUF2346| GO:PFM:NREP 3 GO:PFM GO:0004518|"GO:nuclease activity"|PF01541|IPR000305| GO:PFM GO:0005622|"GO:intracellular"|PF01541|IPR000305| GO:PFM GO:0006281|"GO:DNA repair"|PF01541|IPR000305| RP:SCP:NREP 1 RP:SCP:REP 6->83|1ln0A|3e-11|17.9|78/92|d.226.1.1| HM:SCP:REP 4->80|1mk0A_|2e-13|35.1|77/97|d.226.1.1|1/1|GIY-YIG endonuclease| OP:NHOMO 308 OP:NHOMOORG 307 OP:PATTERN ------------------------11111111------------------------------------ --------------------------------------------------------------------------------11-------------------1-1----1---------------1--------------------------------------1-----------------------------111111-111-11111111111111---11111111111--111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111-11-1111111111111111111---11--1--1111-111-----------------------1----------1111111-11-------1-------------------------------------------------------------------------------1--1------11111111111111111-111111-11111-------------------11--------------1--1-1----11----11111-1---1----1---------------------1---1-------111---------1---------1---------------1----1-1111111111-1111111111111111111-----11-1111111111111111-1111111-----------------1-----11-1--2-------------------------------------------------------111--------1---1111111111-------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 80.8 SQ:SECSTR ####cEEEEEEEcTTccEEEEEEccHHHHHHHHHHHTTccccccccccEEEEEEEEccHHHHHHHHHHHHHccHHHHHHHHHHT############### DISOP:02AL 1-3, 98-99| PSIPRED cccccEEEEEEEcccccEEEEEcccHHHHHHHHHcccccccccccccEEEEEEEEcccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHcccccc //