[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybaJ
DDBJ      :ybaJ         putative methyltransferase
Swiss-Prot:YBAJ_BACSU   RecName: Full=Uncharacterized methyltransferase ybaJ;

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->216 1vl5A PDBj 6e-06 30.1 %
:RPS:PDB   69->244 3bwbB PDBj 1e-13 15.5 %
:RPS:SCOP  57->158 2i6gA1  c.66.1.44 * 2e-15 24.0 %
:HMM:SCOP  8->238 1wznA1 c.66.1.43 * 6.3e-27 24.8 %
:RPS:PFM   57->137 PF03848 * TehB 2e-11 41.8 %
:HMM:PFM   63->158 PF08241 * Methyltransf_11 3.2e-16 36.6 93/95  
:BLT:SWISS 1->255 YBAJ_BACSU e-149 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11927.2 GT:GENE ybaJ GT:PRODUCT putative methyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 155156..155923 GB:FROM 155156 GB:TO 155923 GB:DIRECTION + GB:GENE ybaJ GB:PRODUCT putative methyltransferase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB11927.2 GB:DB_XREF GOA:P70976 InterPro:IPR013216 SubtiList:BG11994 UniProtKB/Swiss-Prot:P70976 GB:GENE:GENE ybaJ LENGTH 255 SQ:AASEQ MNALVAHNSKAWDKKVETGNEWTVAVEQQVIEQAKKGNWDIRVTPMKDVPKDWFPPIKGLKVLCLASGGGQQGPVLAAAGADVTVLDNSEKQLNQDRMIAERDGLTIHTVKGSMDDLSVFNDESFDVIVHPVANVFVENVLPVWKEAYRVLKRNGILISGFVNPVVFLFDTELEQQGVLKVKHSIPYADPEDLPKHKVKKLIENNEALEFGHSLEDQIKGQIDAGFIVTGFYEDKGGFVLDQYIHTYSATRSVKV GT:EXON 1|1-255:0| SW:ID YBAJ_BACSU SW:DE RecName: Full=Uncharacterized methyltransferase ybaJ; SW:GN Name=ybaJ; OrderedLocusNames=BSU01510; SW:KW Complete proteome; Methyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->255|YBAJ_BACSU|e-149|100.0|255/255| GO:SWS:NREP 2 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 48->216|1vl5A|6e-06|30.1|156/226| RP:PDB:NREP 1 RP:PDB:REP 69->244|3bwbB|1e-13|15.5|174/276| RP:PFM:NREP 1 RP:PFM:REP 57->137|PF03848|2e-11|41.8|79/156|TehB| HM:PFM:NREP 1 HM:PFM:REP 63->158|PF08241|3.2e-16|36.6|93/95|Methyltransf_11| RP:SCP:NREP 1 RP:SCP:REP 57->158|2i6gA1|2e-15|24.0|100/177|c.66.1.44| HM:SCP:REP 8->238|1wznA1|6.3e-27|24.8|218/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 57 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ----1------------------------------------1------------------------------111---1---------------------1--------------------------------------------------------------------------------------------11111111----111------11-1-----------------------------------------------------------------------------------------------111---111----------111-111---------11---------------------12--2--------------------------------------------------------------1----------------------1-------------------------------------------------1-------------------------------1------------1------------------------------------------1---------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------1---------------------1111-------------------------------------11---------------1--------------1-1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 98.8 SQ:SECSTR ccccccTTcEEEEEEEEEEEEEEccccEEEEEEETTTEEEEHHHHTTHHHHHHccccTTcEEEEETcTEcTTcHHHHHHccEEEEEEccHHHHHHHHHcHHHHGGGEEEEEccHHHHHHccTTcEEEEEEEccccccccHHHHHHHHHHHEEEEEEEEEEEccTTTcHHHHHHHHHHHHHTccEEEETTEEccTTcTTcccEEEEEEccTTccTTcccccGGGGGGGGcccccHHHHTcccGGGHEEEEEEc### DISOP:02AL 255-256| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEccHHHccccccccccEEEEEHHHHccccHHHHHHHHHHHccccEEEEEEEcccccccccccHHHccccccEEEEcccccccccHHHHHHHHcccccEEccccHHHHHHHHHHcccEEEEEEccccccHHHHHccHHHHHHHccc //