[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybaK
DDBJ      :ybaK         putative alkylated deoxynucleotide triphosphohydrolase
Swiss-Prot:YBAK_BACSU   RecName: Full=Uncharacterized protein ybaK;

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:RPS:PFM   34->146 PF10730 * DUF2521 3e-19 39.8 %
:HMM:PFM   1->147 PF10730 * DUF2521 1.3e-65 50.3 147/147  
:BLT:SWISS 1->147 YBAK_BACSU 3e-68 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11928.1 GT:GENE ybaK GT:PRODUCT putative alkylated deoxynucleotide triphosphohydrolase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 156109..156552 GB:FROM 156109 GB:TO 156552 GB:DIRECTION + GB:GENE ybaK GB:PRODUCT putative alkylated deoxynucleotide triphosphohydrolase GB:FUNCTION 16.8: Protect 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 14679227, 16267290; Product type pe: putative enzyme GB:PROTEIN_ID CAB11928.1 GB:DB_XREF InterPro:IPR019667 SubtiList:BG11503 UniProtKB/Swiss-Prot:P50862 GB:GENE:GENE ybaK LENGTH 147 SQ:AASEQ MAEVLSFMDVKRQKDFELEKNLLKELSLRQIIQSVKDCLEPLFPFLHDERDIITEGCIDFAIEAYLLGGRFGIFGYYGESMQSISARSAREEEELRMEFFDYLYNWIHEQYATFDKNTVYEAARKFIKDWWTAGFVQREKQCKLRMR GT:EXON 1|1-147:0| SW:ID YBAK_BACSU SW:DE RecName: Full=Uncharacterized protein ybaK; SW:GN Name=ybaK; Synonyms=ybxH; OrderedLocusNames=BSU01520; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|YBAK_BACSU|3e-68|100.0|147/100| SEG 14->28|kdfeleknllkelsl| SEG 85->94|sarsareeee| RP:PFM:NREP 1 RP:PFM:REP 34->146|PF10730|3e-19|39.8|113/147|DUF2521| HM:PFM:NREP 1 HM:PFM:REP 1->147|PF10730|1.3e-65|50.3|147/147|DUF2521| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111111---111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //