[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybaS
DDBJ      :ybaS         putative sodium dependent transporter
Swiss-Prot:YBAS_BACSU   RecName: Full=Uncharacterized protein ybaS;

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:306 amino acids
:PSIPRED
:RPS:PFM   35->197 PF01758 * SBF 1e-05 23.3 %
:HMM:PFM   32->200 PF01758 * SBF 2.1e-22 25.7 167/187  
:HMM:PFM   261->296 PF01169 * UPF0016 0.001 27.8 36/78  
:BLT:SWISS 1->306 YBAS_BACSU e-163 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11935.2 GT:GENE ybaS GT:PRODUCT putative sodium dependent transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 178665..179585 GB:FROM 178665 GB:TO 179585 GB:DIRECTION + GB:GENE ybaS GB:PRODUCT putative sodium dependent transporter GB:FUNCTION 7: Transport and binding proteins GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB11935.2 GB:DB_XREF GOA:P55190 InterPro:IPR002657 SubtiList:BG11563 UniProtKB/Swiss-Prot:P55190 GB:GENE:GENE ybaS LENGTH 306 SQ:AASEQ MPLLTPTSVVLGVLLSQFLNGYEWAVPWIFAFITFAGSLSANFQSLRHALSHPLPMILALFVLHIFMPLFAWGSGHLIFKGDPLTITGLTLAVVIPTGITSLIWAAMYKGNVGLTLSIILVDTVLSPLIVPLSLSLLAGAQVHMDVWGMMKGLIVMVVIPSFLGMLFNQMSSPERTAFVSSALSPFSKLCLMAVIAINSSAIAPYFKSIDLRFAGIAVTVFFIALTGYAAAWLIGKMMKRRQEEIVSLIFTGGMRNISAGAVLAVTFFPSQVAVPVVIGMLFQQILAALFGYMLNRFELKPMLQKA GT:EXON 1|1-306:0| SW:ID YBAS_BACSU SW:DE RecName: Full=Uncharacterized protein ybaS; SW:GN Name=ybaS; OrderedLocusNames=BSU01590; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->306|YBAS_BACSU|e-163|100.0|306/306| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 8 TM:REGION 12->34| TM:REGION 51->73| TM:REGION 85->107| TM:REGION 116->138| TM:REGION 149->171| TM:REGION 179->201| TM:REGION 211->233| TM:REGION 265->287| SEG 124->137|vlsplivplslsll| RP:PFM:NREP 1 RP:PFM:REP 35->197|PF01758|1e-05|23.3|163/182|SBF| HM:PFM:NREP 2 HM:PFM:REP 32->200|PF01758|2.1e-22|25.7|167/187|SBF| HM:PFM:REP 261->296|PF01169|0.001|27.8|36/78|UPF0016| GO:PFM:NREP 3 GO:PFM GO:0006814|"GO:sodium ion transport"|PF01758|IPR002657| GO:PFM GO:0008508|"GO:bile acid:sodium symporter activity"|PF01758|IPR002657| GO:PFM GO:0016020|"GO:membrane"|PF01758|IPR002657| OP:NHOMO 43 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -------------1------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1---------------121111--1-111---------111------------------------------------------------------------------------------------------------------------1-----------2----2----1-----------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------1---------------------1------------------------------------------------------------------------------------1----1------------------------------111-------------111-1--11----------------------------------1----111----------------------------------------------------------------------------------------1-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcc //