[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybbC
DDBJ      :ybbC         conserved hypothetical protein
Swiss-Prot:YBBC_BACSU   RecName: Full=Uncharacterized protein ybbC;AltName: Full=ORF2;Flags: Precursor;

Homologs  Archaea  2/68 : Bacteria  128/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:414 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   143->366 1aduB PDBj 2e-41 18.1 %
:RPS:PFM   57->414 PF07075 * DUF1343 e-135 62.0 %
:HMM:PFM   57->414 PF07075 * DUF1343 5.5e-165 60.1 358/362  
:BLT:SWISS 1->414 YBBC_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11941.1 GT:GENE ybbC GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(185194..186438) GB:FROM 185194 GB:TO 186438 GB:DIRECTION - GB:GENE ybbC GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB11941.1 GB:DB_XREF InterPro:IPR008302 SubtiList:BG10833 UniProtKB/Swiss-Prot:P40407 GB:GENE:GENE ybbC LENGTH 414 SQ:AASEQ MRKTIFAFLTGLMMFGTITAASASPDSKNQTAKKPKVQTGIDTLLPDYKKQLKGKRIGLITNPAGVNTSLKSSVDILYENPDIKLTALFGPEHGVRGDAQAGDEVGSYIDEKTGVPVYSLYGKTKKPTPEMLKNVDILMFDIQDVGTRFYTYIYTMAYAMEAAKENGIPFMVLDRPNPQGGNHIEGPILEPEYASFVGLYPIPLKHGMTIGELASLFNKEFSIDADLTVVKMKHWKRKMDFDDTRLPFVLPSPNMPTVESTFVYPATGLIEGTNISEGRGTTKPFELIGAPFIKSTELEETLNSLHLPGVTFRAASFTPTFSKHQGTLCHGVQLYVTDRDKFEAVKTGLSVIKTIHDLYPEDFEFLSTGSFDKLAGNGWIRTKIENGTSVENIINSYEKTLQQFSKTRKKYLIY GT:EXON 1|1-414:0| SW:ID YBBC_BACSU SW:DE RecName: Full=Uncharacterized protein ybbC;AltName: Full=ORF2;Flags: Precursor; SW:GN Name=ybbC; Synonyms=yzbB; OrderedLocusNames=BSU01650; SW:KW Complete proteome; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->414|YBBC_BACSU|0.0|100.0|414/414| RP:PDB:NREP 1 RP:PDB:REP 143->366|1aduB|2e-41|18.1|182/286| RP:PFM:NREP 1 RP:PFM:REP 57->414|PF07075|e-135|62.0|358/362|DUF1343| HM:PFM:NREP 1 HM:PFM:REP 57->414|PF07075|5.5e-165|60.1|358/362|DUF1343| OP:NHOMO 160 OP:NHOMOORG 135 OP:PATTERN -----------------1-------------------------------------------1------ -11-1----------------------------------------11-----1-----------1111-1------------1-----2211-1111--1121111111211111111111111122222222212---------------------------------------------------------1----------------11111---1-1-1-1------1----------------------------------------------------------------------------------------------1-------------------1----2--1--------1----1----411-----------------------------------------------------------------------------------------------------------------------11-1------1----------111------1-1-------11--------------1----------------11111111----------1111-----111111-1------------------------1-----1--1-11--------------------------------------------------------------------------------------------------------1------------------------1------------------------------------------------------------------------------------------222222--------1-1--------------------------11---1---21- ------------------------1------------------------------------------------------------------------------------1----------------------------------------------------1---------------11------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 49.8 SQ:SECSTR ##############################################################################################################################################HHHHHHHHHHHHHHHT############cccTTcccccE#####EEEccGGGccTTccccTcTTccccccccEEcGGGcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccTTcEEEEcccGGTTccccccccccEEEEcTGGGGccTTccccHHHHHHccEEEEEcc#ccccEEcccccccHccEEEHHHHHHHHHHHHHHHHHcccccccccccccc################################################ DISOP:02AL 22-34| PSIPRED cHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccEEEEEEcccccccHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHccEEEEEEccccccccEEccccccHHHHHHHHHHcccccEEEEEEEEcccccHHccccccEEEEEEEccHHccHHHHHHHHHHHHHHHccHHEEccccccHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccc //