[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybbF
DDBJ      :ybbF         putative sugar phosphotransferase enzyme II
Swiss-Prot:PTXBC_BACSU  RecName: Full=Putative PTS system EIIBC component ybbF;Includes:  RecName: Full=Phosphotransferase enzyme IIB component;           EC=2.7.1.69;  AltName: Full=PTS system EIIB component;Includes:  RecName: Full=Permease IIC component;  AltName: Full=PTS system EIIC component;

Homologs  Archaea  0/68 : Bacteria  271/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.95.1
:455 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   7->83 3bp3A PDBj 1e-17 31.6 %
:RPS:SCOP  10->84 3bp8C1  d.95.1.1 * 1e-16 32.4 %
:HMM:SCOP  9->86 1o2fB_ d.95.1.1 * 1.9e-16 51.3 %
:RPS:PFM   11->45 PF00367 * PTS_EIIB 2e-07 60.0 %
:HMM:PFM   120->389 PF02378 * PTS_EIIC 1.2e-40 26.3 266/321  
:HMM:PFM   11->45 PF00367 * PTS_EIIB 1e-17 57.1 35/35  
:BLT:SWISS 1->455 PTXBC_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11944.3 GT:GENE ybbF GT:PRODUCT putative sugar phosphotransferase enzyme II GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(189790..191157) GB:FROM 189790 GB:TO 191157 GB:DIRECTION - GB:GENE ybbF GB:PRODUCT putative sugar phosphotransferase enzyme II GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406, 10627040; Product type pt: putative transporter GB:PROTEIN_ID CAB11944.3 GB:DB_XREF GOA:Q797S1 InterPro:IPR013013 SubtiList:BG11567 UniProtKB/Swiss-Prot:Q797S1 GB:GENE:GENE ybbF LENGTH 455 SQ:AASEQ MSKENNYHHLAQKILELCGGKSNISSYTHCMTRLRITPYDESKADAQALRKLDGVLGVVEAETLQIILGTGVVNHVTAAFSKLVSAEEGADVKEAAAKKKADINRKNATPFKLFLRKIASIFIPLIPALVASGLITGITKAIIQAGWLSADSQIAIILTVIGSGLFTYLGILVGINASKEFGGTPALGALAGILIINPEIAKISLFGEELLPGRGGLIGVLFAAIFIAYTEQFIRRFIPQSLDIIVTPTVSLLITGIVTYVVFMPLGGFISDAITSGLLSILDIGGIAAGFILGATFLPLVVTGLHQGLTPVHMELINSIGNDPLLPILAMGGAGQVGAAFAVFVKTKKTTLRKAIAGGLPSGLLGIGEPLIFGVTLPLGRPFLTACLGAGIGGAFQAYFQVATIAIGVSGLPLSFLVLPSQIILYIVGLFISYAAGFLLTYAFGYKDEMASQFD GT:EXON 1|1-455:0| SW:ID PTXBC_BACSU SW:DE RecName: Full=Putative PTS system EIIBC component ybbF;Includes: RecName: Full=Phosphotransferase enzyme IIB component; EC=2.7.1.69; AltName: Full=PTS system EIIB component;Includes: RecName: Full=Permease IIC component; AltName: Full=PTS system EIIC component; SW:GN Name=ybbF; OrderedLocusNames=BSU01680; SW:KW Cell membrane; Complete proteome; Kinase; Membrane;Phosphotransferase system; Sugar transport; Transferase;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->455|PTXBC_BACSU|0.0|100.0|455/455| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 10 TM:REGION 52->74| TM:REGION 120->142| TM:REGION 155->177| TM:REGION 213->234| TM:REGION 244->266| TM:REGION 281->303| TM:REGION 325->346| TM:REGION 362->384| TM:REGION 399->421| TM:REGION 425->447| SEG 86->101|aeegadvkeaaakkka| SEG 281->295|ildiggiaagfilga| SEG 332->345|ggagqvgaafavfv| RP:PDB:NREP 1 RP:PDB:REP 7->83|3bp3A|1e-17|31.6|76/79| RP:PFM:NREP 1 RP:PFM:REP 11->45|PF00367|2e-07|60.0|35/35|PTS_EIIB| HM:PFM:NREP 2 HM:PFM:REP 120->389|PF02378|1.2e-40|26.3|266/321|PTS_EIIC| HM:PFM:REP 11->45|PF00367|1e-17|57.1|35/35|PTS_EIIB| RP:SCP:NREP 1 RP:SCP:REP 10->84|3bp8C1|1e-16|32.4|74/75|d.95.1.1| HM:SCP:REP 9->86|1o2fB_|1.9e-16|51.3|76/0|d.95.1.1|1/1|Glucose permease domain IIB| OP:NHOMO 833 OP:NHOMOORG 272 OP:PATTERN -------------------------------------------------------------------- -----2--112-3----------------------------------------11--------2---1-1--------2---------------------------------------------------------------------------------------------------------------1-24333333232332323557775432222-145255626--2333333333333332223468--54-1515BC--6622443232344442223333333333332333333333333333451214443---294445435435-8---222---2----------------1-----3---------------------------------------1-----------------------------------------------------------------------------------------------------------------1----------1------------------1-------------------------------------------------------------------------323-------2--------------------------------4663-624333445444-344444344434344444457588543222222222222122253223333--611111111111------------------111322-----1--2-----------------1-1-------------------11113333312122-----------------3---------------------4---1-------131------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 16.9 SQ:SECSTR ######ccccHHHHHHHTTcGGGEEEEEEcccEEEEEEccGGGccHHHHHHTTccEEEEETTEEEEEcGGG#HHHHHHHHHHHT################################################################################################################################################################################################################################################################################################################################################################################### PSIPRED ccccHHHHHHHHHHHHHcccHHHHHHHHHcccEEEEEEccHHHccHHHHHcccccEEEEEccEEEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHcEEEcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccc //