[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybcH
DDBJ      :ybcH         hypothetical protein
Swiss-Prot:YBCH_BACSU   RecName: Full=Uncharacterized protein ybcH;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->51 PF05272 * VirE 0.00011 25.0 40/198  
:BLT:SWISS 1->96 YBCH_BACSU 1e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11963.1 GT:GENE ybcH GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 210224..210514 GB:FROM 210224 GB:TO 210514 GB:DIRECTION + GB:GENE ybcH GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB11963.1 GB:DB_XREF SubtiList:BG12709 UniProtKB/Swiss-Prot:O34795 GB:GENE:GENE ybcH LENGTH 96 SQ:AASEQ MSANLTDFVTKTIEEMNSFDRENMECIKKLIRKAIDFYHLKSYEEVEETHSGNVRFLHVHSMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY GT:EXON 1|1-96:0| SW:ID YBCH_BACSU SW:DE RecName: Full=Uncharacterized protein ybcH; SW:GN Name=ybcH; OrderedLocusNames=BSU01870; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->96|YBCH_BACSU|1e-52|100.0|96/100| HM:PFM:NREP 1 HM:PFM:REP 11->51|PF05272|0.00011|25.0|40/198|VirE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHccccEEEEEHHHHHHHHHHHHEEEEEcccccccccccccccEEEEcc //