[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybcI
DDBJ      :ybcI         conserved hypothetical protein
Swiss-Prot:YBCI_BACSU   RecName: Full=Uncharacterized protein ybcI;

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->112 PF10057 * DUF2294 2e-21 58.7 %
:HMM:PFM   1->118 PF10057 * DUF2294 8.8e-48 53.4 118/118  
:BLT:SWISS 17->124 YBCI_BACSU 9e-58 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11964.1 GT:GENE ybcI GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 210572..210946 GB:FROM 210572 GB:TO 210946 GB:DIRECTION + GB:GENE ybcI GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB11964.1 GB:DB_XREF InterPro:IPR018745 SubtiList:BG12710 UniProtKB/Swiss-Prot:O34380 GB:GENE:GENE ybcI LENGTH 124 SQ:AASEQ MKKSKGSIESEISKSITQWEKDYLGRGSVSVKTDILRDMIIVNLKGILTPAEYVVCGSKEGMLSIKQTRSELVESGIEGLKDIILKITGEKVKSFHTDLSSRTGERVMVFKLCNDLEKNLEKIL GT:EXON 1|1-124:0| SW:ID YBCI_BACSU SW:DE RecName: Full=Uncharacterized protein ybcI; SW:GN Name=ybcI; OrderedLocusNames=BSU01880; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 17->124|YBCI_BACSU|9e-58|100.0|108/100| SEG 2->16|kkskgsieseisksi| RP:PFM:NREP 1 RP:PFM:REP 21->112|PF10057|2e-21|58.7|92/115|DUF2294| HM:PFM:NREP 1 HM:PFM:REP 1->118|PF10057|8.8e-48|53.4|118/118|DUF2294| OP:NHOMO 53 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111111111111111-111-111-111---1------1--11111111111111-1111----------------------------------------------------------------------1-----------------------------------2------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEHHccHHHHHHHHHc //