[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybcM
DDBJ      :ybcM         putative enzyme
Swiss-Prot:YBCM_BACSU   RecName: Full=Uncharacterized protein ybcM;

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->87 YBCM_BACSU 4e-47 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11983.1 GT:GENE ybcM GT:PRODUCT putative enzyme GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 213155..213469 GB:FROM 213155 GB:TO 213469 GB:DIRECTION + GB:GENE ybcM GB:PRODUCT putative enzyme GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB11983.1 GB:DB_XREF GOA:O31421 SubtiList:BG12712 UniProtKB/Swiss-Prot:O31421 GB:GENE:GENE ybcM LENGTH 104 SQ:AASEQ MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVNTCIISLKGLDNADDRFVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE GT:EXON 1|1-104:0| SW:ID YBCM_BACSU SW:DE RecName: Full=Uncharacterized protein ybcM; SW:GN Name=ybcM; OrderedLocusNames=BSU01900; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->87|YBCM_BACSU|4e-47|100.0|87/104| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 74->96| SEG 88->103|isvvmsissvmksvtv| OP:NHOMO 28 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-111111-111-2111111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccHHHHccHHHHHHcccccEEEccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcc //