[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybdJ
DDBJ      :ybdJ         two-component response regulator [YbdK]
Swiss-Prot:YBDJ_BACSU   RecName: Full=Uncharacterized transcriptional regulatory protein ybdJ;

Homologs  Archaea  11/68 : Bacteria  837/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->105 1mvoA PDBj 3e-18 41.6 %
:BLT:PDB   155->216 2hqnA PDBj 1e-05 30.6 %
:RPS:PDB   5->215 3c3wB PDBj 5e-22 13.6 %
:RPS:SCOP  4->105 1p2fA2  c.23.1.1 * 2e-23 34.7 %
:RPS:SCOP  125->218 1ys6A1  a.4.6.1 * 2e-12 20.7 %
:HMM:SCOP  1->181 1s8nA_ c.23.1.1 * 4.1e-32 33.3 %
:RPS:PFM   6->105 PF00072 * Response_reg 1e-17 40.0 %
:RPS:PFM   146->217 PF00486 * Trans_reg_C 3e-06 33.3 %
:HMM:PFM   6->111 PF00072 * Response_reg 7.4e-24 34.0 106/112  
:HMM:PFM   146->217 PF00486 * Trans_reg_C 1.5e-17 36.1 72/77  
:BLT:SWISS 1->223 YBDJ_BACSU e-120 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11994.1 GT:GENE ybdJ GT:PRODUCT two-component response regulator [YbdK] GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 221258..221929 GB:FROM 221258 GB:TO 221929 GB:DIRECTION + GB:GENE ybdJ GB:PRODUCT two-component response regulator [YbdK] GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11717295; Product type r: regulator GB:PROTEIN_ID CAB11994.1 GB:DB_XREF GOA:O31432 HSSP:1KGS InterPro:IPR011991 SubtiList:BG12723 UniProtKB/Swiss-Prot:O31432 GB:GENE:GENE ybdJ LENGTH 223 SQ:AASEQ MKGYRILIVEDDVMIGDLLQKILQREGYRVIWKTDGADVLSVIQKVDLVIMDVMLPGEDGYQMSAKIKKLGLGIPVIFLSARNDMDSKLQGLQIGEDYMVKPFDPRELLLRMRNMLEHHYGTFTQIKHLYIDAVTKKVFNESLHDEVLFTAIERKIFFYLYENRDSILTKEHFFEYLWQLEDRNPNIVNVHIKKIRAKINDQAGEMIENIYGEGYRLNTVVKK GT:EXON 1|1-223:0| SW:ID YBDJ_BACSU SW:DE RecName: Full=Uncharacterized transcriptional regulatory protein ybdJ; SW:GN Name=ybdJ; OrderedLocusNames=BSU02000; SW:KW Complete proteome; Cytoplasm; DNA-binding; Phosphoprotein;Transcription; Transcription regulation;Two-component regulatory system. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->223|YBDJ_BACSU|e-120|100.0|223/223| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|Two-component regulatory system| SEG 106->117|relllrmrnmle| BL:PDB:NREP 2 BL:PDB:REP 5->105|1mvoA|3e-18|41.6|101/121| BL:PDB:REP 155->216|2hqnA|1e-05|30.6|62/109| RP:PDB:NREP 1 RP:PDB:REP 5->215|3c3wB|5e-22|13.6|199/210| RP:PFM:NREP 2 RP:PFM:REP 6->105|PF00072|1e-17|40.0|100/111|Response_reg| RP:PFM:REP 146->217|PF00486|3e-06|33.3|72/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 6->111|PF00072|7.4e-24|34.0|106/112|Response_reg| HM:PFM:REP 146->217|PF00486|1.5e-17|36.1|72/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 4->105|1p2fA2|2e-23|34.7|101/120|c.23.1.1| RP:SCP:REP 125->218|1ys6A1|2e-12|20.7|92/106|a.4.6.1| HM:SCP:REP 1->181|1s8nA_|4.1e-32|33.3|174/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 8516 OP:NHOMOORG 876 OP:PATTERN --------------------------------------1111111-18-5--2--------------- 6FE4645555533487788-8A3378888887DCBD6AA8668B4643443354825611BCB4E59HFE4233344455D9612364AANF-622---43B479K4H7E--------------222253213372JKKOL625O4WJRIJI6BCBC656767GH9CWXeD3634445534444B46623296ITTUTUSTTIURWWTQFJDBDEUUbABCU8DD98898AeU777777767777777677968474AB4432555559A545575464BCB555787777777777777455555555655584543255566PJKYOOOPRPQPMGBZTT99D8NIF89BBL83WVIEA526757676127CB5766655444C6EIGA8C9F9BDCCACCCCBBAD-CCDBAICB8F61LBBKHFEKJJDDCJ6A9556B6AB585BBBBBBBB78788DB911111111--11232232322322321212267268A969JLLLMHDAAA8IIJMB9BC6FJIIEHFK12BFAHACDCQCHII7DFB7678B6-------8629FE6GHC83C44DB5481KCHEIIG7E9B6AGH6FF7796665557-2121--1-9G79E55GE7BCFE5DECGAGGDBGCGEEHGEGGIII--15655------C9AC9D8CDBDCDDECC-DEDCCCCCCEDCCCCCCCBHGG9B777ECDEEEEEDEEEEEEDBBABCCCC4-999999998999--1A3333323225AQ8G322222133432114CB99C8A799E9MLMLKUTTIKOMPHMMO11-1-11-14CDDIBBBBBCGGGGIKBACAA9A97767--I144666621111-1-2-2-------------------------37343353433B3 --------------2--------------------------------------------111--1-1-----1--1-1111----------------1---1--------------------------------------------------------2----2-1-------3--131A---1-3--7-21--5---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 97.8 SQ:SECSTR HHHHEEEEEcccHHHHHHHHHHHHTcTTEEEEEEcHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGHHHHGGccHHHHHHHHHHHHHHHHHcTTTccHHHHHHHHHHTTTccHHHHHHHHTcTTEEEcTccHHHHHHHHHHHHHHTTccccHHHHHHHHHTcccc##### DISOP:02AL 1-2, 221-223| PSIPRED ccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccEEEccEEEEcccEEEEEcccccEEEccHHHHHHHHHHHHcccccccHHHHHHHHcccccccccEEHHHHHHHHHHHccccccEEEEEEcccEEEcccccc //