[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybdM
DDBJ      :ybdM         putative protein kinase
Swiss-Prot:YBDM_BACSU   RecName: Full=Probable serine/threonine-protein kinase ybdM;         EC=2.7.11.1;

Homologs  Archaea  1/68 : Bacteria  310/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->200 3f61A PDBj 4e-14 27.9 %
:RPS:PDB   23->173 3ei1A PDBj 6e-22 4.6 %
:RPS:SCOP  21->200 1mruA  d.144.1.7 * 3e-17 25.7 %
:HMM:SCOP  20->237 1csnA_ d.144.1.7 * 3.1e-43 34.4 %
:RPS:PFM   31->173 PF00069 * Pkinase 1e-16 36.2 %
:HMM:PFM   25->176 PF00069 * Pkinase 9.1e-34 34.5 148/260  
:BLT:SWISS 1->256 YBDM_BACSU e-126 100.0 %
:PROS 31->54|PS00107|PROTEIN_KINASE_ATP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11997.1 GT:GENE ybdM GT:PRODUCT putative protein kinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(223219..223989) GB:FROM 223219 GB:TO 223989 GB:DIRECTION - GB:GENE ybdM GB:PRODUCT putative protein kinase GB:FUNCTION 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB11997.1 GB:DB_XREF GOA:O31435 InterPro:IPR008271 SubtiList:BG12726 UniProtKB/Swiss-Prot:O31435 GB:GENE:GENE ybdM LENGTH 256 SQ:AASEQ MALKLLKKLLFDRPLKNGVILNHQYKIEECLGMGGYGLVYLCTDILAQTPYVLKQLRPTKAKKEKEKVRFQQEIKLLKNIHHPQIPGFIDEFIIDGQAYYVMQFIEGENIEELLFFRKQPFTELMALQLISQLLEIIEYLHDRLIFHSDIRTPNIIINDGRLCLIDFGLAKQLTPEEMEEIKVRKQDDFFDLGETLLFLLYSQYKGKKKKNGTWLEELTLTKEVTLLLKRLLGIEEEYQHTASIREDLNRAIQSVT GT:EXON 1|1-256:0| SW:ID YBDM_BACSU SW:DE RecName: Full=Probable serine/threonine-protein kinase ybdM; EC=2.7.11.1; SW:GN Name=ybdM; OrderedLocusNames=BSU02030; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Serine/threonine-protein kinase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->256|YBDM_BACSU|e-126|100.0|256/256| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0004674|"GO:protein serine/threonine kinase activity"|Serine/threonine-protein kinase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 31->54|PS00107|PROTEIN_KINASE_ATP|PDOC00100| SEG 127->140|lqlisqlleiieyl| SEG 215->232|leeltltkevtlllkrll| BL:PDB:NREP 1 BL:PDB:REP 21->200|3f61A|4e-14|27.9|179/271| RP:PDB:NREP 1 RP:PDB:REP 23->173|3ei1A|6e-22|4.6|151/1105| RP:PFM:NREP 1 RP:PFM:REP 31->173|PF00069|1e-16|36.2|141/256|Pkinase| HM:PFM:NREP 1 HM:PFM:REP 25->176|PF00069|9.1e-34|34.5|148/260|Pkinase| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF00069|IPR017442| GO:PFM GO:0005524|"GO:ATP binding"|PF00069|IPR017442| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF00069|IPR017442| RP:SCP:NREP 1 RP:SCP:REP 21->200|1mruA|3e-17|25.7|179/269|d.144.1.7| HM:SCP:REP 20->237|1csnA_|3.1e-43|34.4|212/0|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 1941 OP:NHOMOORG 491 OP:PATTERN -------------------------------------------------------------1------ 1CN-5322123--121122-23116222222325553231111311-11111211111--1-1---531451111----11-2-------1--1--------------1---------------2--------2--55565---F1X6IB88B4322------4264QKSK------------1111111212-22222222222222111221222212221-1----1133111111-111111111111111111111111--11111-1--111111111111111111-111111111111111111111111111111--21---11-11---111-111---1---3111111111121--11---E-8----------1------------------------------------------------1----1-------1--------1------------------------------------------------------1111---11111-1----1---1----1-----1-----11111------------121-41-1-------------2-----22128X----------------------------------1--1---------------1--------------------------------------------------------------------------------------------------------2-----------2-1--------------------------11111---------------------------------1-------------------2-------------------------1--1---------------1----------2 3224675-955322523221111-1-1222212222122222211123211111-----11125433--1-53354332312225323-21132233-21221498-449CAFA8CE66558F5Yi3P3v*M3VKd5536B29GB67663J43M3FN8897IA4731D679AG96142-7---1-687A2G31234263 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 81.2 SQ:SECSTR ######GGGTHHcccccccccGEccccccEEEEEccccccccEEEEEETTEEEEEEccTTccEEEEEEEccccEEEEEEEccTTccccEEEEEETTcEEEEEEEEEETTEEEEEEEEEEEcccccccccTTccEEEEcTTccEEEEEccTTEEEEEEcTTcTTcccEEEEcccGGccHHHHHTTcccGGGHHHHHHHHHHHHHHHcccHHHTcc########################################## DISOP:02AL 1-3, 254-256| PSIPRED cHHHHHHHHHHccccccccEEcccEEEEEEEEccccEEEEEEEEcccccEEEEEEEcHHHcccHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEcccEEEEEcccHHHccHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccEEEEccccHHHHHHHHHHcccccccccHHHHHHHHHHHHcccc //