[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybeF
DDBJ      :ybeF         conserved hypothetical protein
Swiss-Prot:YBEF_BACSU   RecName: Full=Uncharacterized protein ybeF;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->78 PF10852 * DUF2651 2e-09 42.3 %
:HMM:PFM   1->82 PF10852 * DUF2651 1.1e-43 64.6 82/82  
:BLT:SWISS 1->82 YBEF_BACSU 2e-42 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12009.1 GT:GENE ybeF GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 235625..235873 GB:FROM 235625 GB:TO 235873 GB:DIRECTION + GB:GENE ybeF GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12009.1 GB:DB_XREF GOA:O31442 SubtiList:BG12731 UniProtKB/Swiss-Prot:O31442 GB:GENE:GENE ybeF LENGTH 82 SQ:AASEQ MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN GT:EXON 1|1-82:0| SW:ID YBEF_BACSU SW:DE RecName: Full=Uncharacterized protein ybeF; SW:GN Name=ybeF; OrderedLocusNames=BSU02150; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|YBEF_BACSU|2e-42|100.0|82/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 4->26| TM:REGION 29->51| TM:REGION 53->74| RP:PFM:NREP 1 RP:PFM:REP 1->78|PF10852|2e-09|42.3|78/82|DUF2651| HM:PFM:NREP 1 HM:PFM:REP 1->82|PF10852|1.1e-43|64.6|82/82|DUF2651| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-----1-------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 78-82| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //