[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybfE
DDBJ      :ybfE         hypothetical protein
Swiss-Prot:YBFE_BACSU   RecName: Full=Uncharacterized protein ybfE;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:HMM:PFM   13->80 PF04647 * AgrB 0.00016 21.5 65/185  
:BLT:SWISS 1->94 YBFE_BACSU 1e-50 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12012.2 GT:GENE ybfE GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(238164..238448) GB:FROM 238164 GB:TO 238448 GB:DIRECTION - GB:GENE ybfE GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12012.2 GB:DB_XREF GOA:O31445 SubtiList:BG12734 UniProtKB/Swiss-Prot:O31445 GB:GENE:GENE ybfE LENGTH 94 SQ:AASEQ MNHCLHSNTLAKIVCTVTLITLYFYFFSTRFNELIELAVQMFFALIGLFWVFIVSPFSRKVQISERFKQKSENARIVGMIDFVLEQKYKKSISE GT:EXON 1|1-94:0| SW:ID YBFE_BACSU SW:DE RecName: Full=Uncharacterized protein ybfE; SW:GN Name=ybfE; OrderedLocusNames=BSU02180; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|YBFE_BACSU|1e-50|100.0|94/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 7->29| TM:REGION 35->57| HM:PFM:NREP 1 HM:PFM:REP 13->80|PF04647|0.00016|21.5|65/185|AgrB| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcc //