[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybxG
DDBJ      :ybxG         putative amino acid permease
Swiss-Prot:YBXG_BACSU   RecName: Full=Uncharacterized transporter ybxG;

Homologs  Archaea  1/68 : Bacteria  424/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
:462 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->142 3h6bC PDBj 2e-05 22.7 %
:BLT:PDB   210->323 3giaA PDBj 7e-05 23.6 %
:RPS:PFM   17->436 PF00324 * AA_permease 6e-39 31.9 %
:HMM:PFM   14->424 PF00324 * AA_permease 1.3e-105 36.6 407/479  
:BLT:SWISS 1->462 YBXG_BACSU 0.0 100.0 %
:PROS 39->69|PS00218|AMINO_ACID_PERMEASE_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12000.1 GT:GENE ybxG GT:PRODUCT putative amino acid permease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 226566..227954 GB:FROM 226566 GB:TO 227954 GB:DIRECTION + GB:GENE ybxG GB:PRODUCT putative amino acid permease GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB12000.1 GB:DB_XREF GOA:P54425 InterPro:IPR004841 SubtiList:BG11505 UniProtKB/Swiss-Prot:P54425 GB:GENE:GENE ybxG LENGTH 462 SQ:AASEQ MANKELKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLLAYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPMAGYITAWSNWFQWIIVGMSEIIAVGSYTKYWFPDLPAWIPGIVAMVILGAANLISVKSFGEFEFWFAMIKIVTIILMIIAGIGIIFFGFGNGGDAIGLSNLWSHGGFFAGGFSGFFFALSLVIAAYQGVELIGITAGEAKDPQNTLRNAIQSIIWRILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGITAAAGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTIAVLIGLAVGVVLNYIAPPKIFVYVYSASVLPGMIPWFIILISHIGFRKAKGAALDKHPFKMPFAPFTNYLTIAFLLMVLVGMWFNDDTRISLIVGVIFLALVVISYYVFGIGKRTQANLTKSEQAAE GT:EXON 1|1-462:0| SW:ID YBXG_BACSU SW:DE RecName: Full=Uncharacterized transporter ybxG; SW:GN Name=ybxG; Synonyms=ybdP; OrderedLocusNames=BSU02060; SW:KW Amino-acid transport; Cell membrane; Complete proteome; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->462|YBXG_BACSU|0.0|100.0|462/462| GO:SWS:NREP 5 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 39->69|PS00218|AMINO_ACID_PERMEASE_1|PDOC00191| TM:NTM 12 TM:REGION 13->35| TM:REGION 39->61| TM:REGION 93->115| TM:REGION 120->142| TM:REGION 151->173| TM:REGION 198->220| TM:REGION 234->256| TM:REGION 269->291| TM:REGION 328->350| TM:REGION 357->379| TM:REGION 401->422| TM:REGION 426->447| SEG 154->182|ikivtiilmiiagigiiffgfgnggdaig| SEG 190->206|ggffaggfsgfffalsl| SEG 335->347|iavliglavgvvl| BL:PDB:NREP 2 BL:PDB:REP 10->142|3h6bC|2e-05|22.7|132/411| BL:PDB:REP 210->323|3giaA|7e-05|23.6|110/433| RP:PFM:NREP 1 RP:PFM:REP 17->436|PF00324|6e-39|31.9|414/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 14->424|PF00324|1.3e-105|36.6|407/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 3350 OP:NHOMOORG 524 OP:PATTERN -----------------------------------------------1-------------------- ----142333424251144-412253444443-11117DC----2-21122298A824-----A119544-4222444-----------------------1-----------------------------------------------------------------------------------------3-A7797878868A788911669C88743591712222227155555555555555466667144254273546677432536416662221111-22-----------1111111111111-212221111---44111111111---441211----------2213--1-11----------1---34334-------------1-111111112------2------111-111--1--1--------------44444444-221------------------------------------1--211-18CCCC836565AA33888848E825555-1332--1--7----1-------31---------------------3--------------------------1-------2-1112111-------111---------------------------1------------88776959888988888-88A8888878888888888CCC797749899999999999899B88877784-888788788888--3------1111--------------------GGHHEB8-----88789A49-DHDB1333333333333---------------2233333333--------------------------------------------------------------- ------------322HGBBLGEBNLMM997788CDCCCCCC9D999GGGHOTiZDDG99AAAFNPFGJ4KEDNDOIGAHIDJJMQNC8-5K4G5AC6463988879----------------------------------------------------2-----------4--------------1--1B----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 52.6 SQ:SECSTR #########ccHHHHHHHHHHHHccccTTHHHHHHHHHcccccTHHHHHHHHHHHHHHHHHHHHHHHccccccTHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHGGGcccccccTHHHHHHHHHHHHHHHHHHHccH###################################################################GGTHHHHHHTTGGGcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHTGGGHHHHHHHHHH####HHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHccccccccT########################################################################################################################################### DISOP:02AL 1-4, 453-462| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccHHHccc //