[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybxI
DDBJ      :ybxI         exported beta-lactamase
Swiss-Prot:YBXI_BACSU   RecName: Full=Probable beta-lactamase ybxI;         EC=3.5.2.6;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  126/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.3.1
:267 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   46->265 3hbrB PDBj 3e-43 42.2 %
:RPS:PDB   45->263 1e3uD PDBj 1e-23 36.6 %
:RPS:SCOP  44->265 1e3uA  e.3.1.1 * 2e-79 36.9 %
:HMM:SCOP  47->265 1e3uA_ e.3.1.1 * 5.5e-38 26.5 %
:HMM:PFM   47->251 PF00905 * Transpeptidase 1.1e-39 26.5 196/304  
:HMM:PFM   3->82 PF01312 * Bac_export_2 2.9e-05 17.7 79/343  
:BLT:SWISS 1->267 YBXI_BACSU e-157 100.0 %
:PROS 74->84|PS00337|BETA_LACTAMASE_D
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12003.1 GT:GENE ybxI GT:PRODUCT exported beta-lactamase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(228549..229352) GB:FROM 228549 GB:TO 229352 GB:DIRECTION - GB:GENE ybxI GB:PRODUCT exported beta-lactamase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 14742199; Product type e: enzyme GB:PROTEIN_ID CAB12003.1 GB:DB_XREF GOA:P54427 HSSP:1K38 InterPro:IPR001460 SubtiList:BG11507 UniProtKB/Swiss-Prot:P54427 GB:GENE:GENE ybxI LENGTH 267 SQ:AASEQ MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKDTDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS GT:EXON 1|1-267:0| SW:ID YBXI_BACSU SW:DE RecName: Full=Probable beta-lactamase ybxI; EC=3.5.2.6;Flags: Precursor; SW:GN Name=ybxI; Synonyms=ybdS; OrderedLocusNames=BSU02090; SW:KW Antibiotic resistance; Complete proteome; Hydrolase; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->267|YBXI_BACSU|e-157|100.0|267/267| GO:SWS:NREP 2 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| PROS 74->84|PS00337|BETA_LACTAMASE_D|PDOC00134| TM:NTM 1 TM:REGION 4->26| BL:PDB:NREP 1 BL:PDB:REP 46->265|3hbrB|3e-43|42.2|218/240| RP:PDB:NREP 1 RP:PDB:REP 45->263|1e3uD|1e-23|36.6|216/242| HM:PFM:NREP 2 HM:PFM:REP 47->251|PF00905|1.1e-39|26.5|196/304|Transpeptidase| HM:PFM:REP 3->82|PF01312|2.9e-05|17.7|79/343|Bac_export_2| RP:SCP:NREP 1 RP:SCP:REP 44->265|1e3uA|2e-79|36.9|222/243|e.3.1.1| HM:SCP:REP 47->265|1e3uA_|5.5e-38|26.5|219/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| OP:NHOMO 144 OP:NHOMOORG 126 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------11------------------1--111--111----------1-----------------1--111---------------------------------------2-1111----------------1-112121----221-1-231--------------------------------------------------------------------------------1--1---2-----------------------------------------------111----1111---------------------11--111---------1-1---------11--------------1---------------11--1----------------------1111-1--------1111-11--1-1---221-----2---------1-----------------1--------11--1----1--1-1--------1----11-1-1---------1------11----11----1111--1111111111-----------------------------------------------------------------------------------------------------------12111-------------------214121------1111---------1-------------------------------------------1---1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 93.6 SQ:SECSTR ################ccHHHHHHTTccccccccccTTccccccTccEEEEEEEccTTcEEEccHHHHTcEEccGGGGHHHHHHHHHHHTccccTTcEEcccccccccGGGGccEEHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHTTcTTccccccTTTTTTTccccEEHHHHHHHHHHHHTTcccccHHHHHHHHHHTEEEEETTEEEEEEEEEcccccEEEEEEEEEEETTEEEEEEEEEEGGTTHHHHHHHHHHHHTTccH# PSIPRED cHHHHHHHHHHHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEcHHHHccccccccHHHHHHHHHHHHcccccccccEEcccccccccccccccccHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHEEEEcccEEEEEEEEccccccccEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHcccccc //