[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ybyB
DDBJ      :ybyB         conserved hypothetical protein
Swiss-Prot:YBYB_BACSU   RecName: Full=Uncharacterized protein ybyB;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->15 PF11131 * PhrC_PhrF 8.3e-05 40.0 15/37  
:BLT:SWISS 1->86 YBYB_BACSU 7e-47 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12005.1 GT:GENE ybyB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(230819..231079) GB:FROM 230819 GB:TO 231079 GB:DIRECTION - GB:GENE ybyB GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12005.1 GB:DB_XREF SubtiList:BG12754 UniProtKB/Swiss-Prot:O31441 GB:GENE:GENE ybyB LENGTH 86 SQ:AASEQ MKQKLLLSGLAVSTVGITSYLLKDPSNRQKAREFIHSMKMKITKQPDMETFPVDKAGHPDPQDIEDNKMVSEGSMYPVQYYDEKKK GT:EXON 1|1-86:0| SW:ID YBYB_BACSU SW:DE RecName: Full=Uncharacterized protein ybyB;Flags: Precursor; SW:GN Name=ybyB; OrderedLocusNames=BSU02110; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->86|YBYB_BACSU|7e-47|100.0|86/100| HM:PFM:NREP 1 HM:PFM:REP 1->15|PF11131|8.3e-05|40.0|15/37|PhrC_PhrF| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 41-42, 44-62, 82-86| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccc //