[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ycbO
DDBJ      :ycbO         putative Na+-driven exporter or maturation protein
Swiss-Prot:YCBO_BACSU   RecName: Full=Uncharacterized protein ycbO;

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->228 YCBO_BACSU e-111 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12052.3 GT:GENE ycbO GT:PRODUCT putative Na+-driven exporter or maturation protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 281028..281714 GB:FROM 281028 GB:TO 281714 GB:DIRECTION + GB:GENE ycbO GB:PRODUCT putative Na+-driven exporter or maturation protein GB:FUNCTION 16.1: Circulate 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB12052.3 GB:DB_XREF GOA:P42247 SubtiList:BG11170 UniProtKB/Swiss-Prot:P42247 GB:GENE:GENE ycbO LENGTH 228 SQ:AASEQ MNLIRIELRKMKMGWYIRGALIANVIIMGFMWLISYSEKADGGVSFQSTDEAFLIIGTFVRAVFIVFGAVLIVKLVISEYKNKTILVMFTYPISRKKLLTAKLMIAGGLTFITILLSNILIAAGFFWLNSICHFIPGELTSEIISQQAVKMAVFAFGAAGTSLVPIFFGMRRHSVPATIISSVVIVMLISSTSPGFSISSVVYIPLSLAAFGLFFSYMAIRNADKQDA GT:EXON 1|1-228:0| SW:ID YCBO_BACSU SW:DE RecName: Full=Uncharacterized protein ycbO; SW:GN Name=ycbO; OrderedLocusNames=BSU02580; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->228|YCBO_BACSU|e-111|100.0|228/228| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 15->37| TM:REGION 60->81| TM:REGION 105->127| TM:REGION 149->170| TM:REGION 173->195| TM:REGION 198->220| SEG 179->200|iissvvivmlisstspgfsiss| OP:NHOMO 54 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12222222312222222122-1222---1---------1------------------------------------1-------------------------1------------------------------------11-1----1-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 228-229| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcc //