[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yccK
DDBJ      :yccK         putative ion channel associated enzyme
Swiss-Prot:YCCK_BACSU   RecName: Full=Uncharacterized oxidoreductase yccK;         EC=1.-.-.-;

Homologs  Archaea  52/68 : Bacteria  718/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.1.7
:310 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->309 1pyfA PDBj 1e-93 54.3 %
:RPS:PDB   1->310 3eb4A PDBj 1e-71 27.2 %
:RPS:SCOP  3->310 1pyfA  c.1.7.1 * 2e-96 53.1 %
:HMM:SCOP  1->311 1pz1A_ c.1.7.1 * 6.7e-98 45.6 %
:RPS:PFM   17->302 PF00248 * Aldo_ket_red 1e-60 48.3 %
:HMM:PFM   16->309 PF00248 * Aldo_ket_red 2.1e-81 40.7 280/284  
:BLT:SWISS 1->310 YCCK_BACSU e-178 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12071.1 GT:GENE yccK GT:PRODUCT putative ion channel associated enzyme GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 298466..299398 GB:FROM 298466 GB:TO 299398 GB:DIRECTION + GB:GENE yccK GB:PRODUCT putative ion channel associated enzyme GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 17322186; Product type pe : putative enzyme GB:PROTEIN_ID CAB12071.1 GB:DB_XREF GOA:P46905 HSSP:1GVE InterPro:IPR020471 SubtiList:BG11340 UniProtKB/Swiss-Prot:P46905 GB:GENE:GENE yccK LENGTH 310 SQ:AASEQ MDQTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTALDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATKGAHKEVDGSIELDNSREFLRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQLQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGLLTGKFTQDTVFDDFRKDKPQFQGETFIHNLKKVDKLKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAKRPEQLQDNLKTLNIELTEDEVNFISDIFK GT:EXON 1|1-310:0| SW:ID YCCK_BACSU SW:DE RecName: Full=Uncharacterized oxidoreductase yccK; EC=1.-.-.-; SW:GN Name=yccK; Synonyms=yzaE; OrderedLocusNames=BSU02770; SW:KW Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->310|YCCK_BACSU|e-178|100.0|310/310| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 7->309|1pyfA|1e-93|54.3|300/309| RP:PDB:NREP 1 RP:PDB:REP 1->310|3eb4A|1e-71|27.2|305/327| RP:PFM:NREP 1 RP:PFM:REP 17->302|PF00248|1e-60|48.3|269/281|Aldo_ket_red| HM:PFM:NREP 1 HM:PFM:REP 16->309|PF00248|2.1e-81|40.7|280/284|Aldo_ket_red| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00248|IPR001395| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00248|IPR001395| RP:SCP:NREP 1 RP:SCP:REP 3->310|1pyfA|2e-96|53.1|307/311|c.1.7.1| HM:SCP:REP 1->311|1pz1A_|6.7e-98|45.6|309/0|c.1.7.1|1/1|NAD(P)-linked oxidoreductase| OP:NHOMO 6017 OP:NHOMOORG 964 OP:PATTERN 322-3223666656632A44314-944D2EA432----2-11232--2-1634-1-1---16433-21 6AL3V11356513126522-24113E222222465657998F8NFHD35HF2DGI43A--9874J3HLNG55333575---351-11-5832-3-----117142J1735--------------11-1111--12212254111D-545823322111111--2218A5I51-11111-11--89311431A3888888968457778764555876724647777777768O2665666666666665444536B15613523AA6688247288343322211113322222222222111-111111111222111222332-27333333323331------7-31-31312--2121342123142-23-5A444-----B7888--35544411111111118-56967F5A8H1-PHHAJKHVQJFH9646135732347443333333379852134-----------------------------12653525546CCDCDDA545499DC555636E9J5665--33362522535772141-3112-----------132121--2---32--1-4121-24315887BL-31-2---------21-1--111--11133394341-7242222223132121112112--1-111------5659297788A7AAA88-9778A967A79AD777778BC9871224375756556765667957665761-966666656666-----1-1--111-3385---7-5-------1-4433435122E388685899687795978211-12--11-12211111221226588A885554111--14221222111-1-----3----1-------------2------22621656663B7 11--534-7311134LFGCJIMDPOUO5523339455757577444JEKVINXOJJC99BAB7392695659B58594896AA95565-g*TFHkEBA9E857LCE-2FFSIKA99F6743B89LD2I6XwF1FEG2412936KJ35232E34A4A55D5663EB52437HH9833B79u5689GMHMOCHK77VFRH9 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 100.0 SQ:SECSTR cccEEEccccccEEEcEEEEcTTcccTcHHccccHHHHHHHHHHHHHTTccEEEccTTGGGGHHHHHHHHHHHHHTcGGGcEEEEEEcccccccGGGccccHHHHHHHHHHHHHHHTcccEEEEEEccccTTccHHHHHHHHHHHHHTTcEEEEEEEcccHHHHHHHHHHccccEEEEEccTTccHHHHHHHHHHHHHccEEEEEcTTGGGGGGTTTTTcccTTTcHHHHHHHHcHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTccTTccEEEEccccHHHHHHHHTHHHHGccHHHHHHHHHHHc PSIPRED cccEEEccccccEEccEEEEccccccccccccccHHHHHHHHHHHHHccccEEEccHHHcccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccccHHcccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHcc //