[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ycdA
DDBJ      :ycdA         putative lipoprotein
Swiss-Prot:YCDA_BACSU   RecName: Full=Uncharacterized lipoprotein ycdA;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.25
:354 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   128->303 2ioqB PDBj 1e-04 28.5 %
:RPS:PDB   45->165 3cfuB PDBj 3e-13 18.5 %
:RPS:SCOP  45->141 1xo8A  b.1.25.1 * 2e-04 14.4 %
:RPS:PFM   44->142 PF11611 * TRF2 5e-05 34.7 %
:HMM:PFM   40->148 PF11611 * TRF2 5.3e-26 34.3 108/123  
:BLT:SWISS 1->354 YCDA_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12072.1 GT:GENE ycdA GT:PRODUCT putative lipoprotein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(299438..300502) GB:FROM 299438 GB:TO 300502 GB:DIRECTION - GB:GENE ycdA GB:PRODUCT putative lipoprotein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type lp: lipoprotein GB:PROTEIN_ID CAB12072.1 GB:DB_XREF GOA:O34538 SubtiList:BG12757 UniProtKB/Swiss-Prot:O34538 GB:GENE:GENE ycdA LENGTH 354 SQ:AASEQ MFQKKTYAVFLILLLMMFTAACSGSKTSAEKKESETEKSSDIAQVKIKDVSYTLPSKYDKSTSDDQLVLKVNVAVKNTGKDPLNVDSMDFTLYQGDTKMSDTDPEDYSEKLQGSTINADKSVEGNLFFVVDKGKQYELNYTPESYGDKKPKSVTFKIDGKDKKILATADKLQDSAKALSAYVDVLLFGKDNADFEKITGANKNEIVNDFNESAKDGYLSASGLSSTYADSKALDNIVNGIKEGLSKNSSIQAKTTSISKDEAIVEATVKPVDASSLSDRIEDKVKDYYSKNSSASYEEAVKYALQVYPEEFKKLGPASSEKTVEVKMKKNDIDQWQLDMDDYRAAELVEAFIKE GT:EXON 1|1-354:0| SW:ID YCDA_BACSU SW:DE RecName: Full=Uncharacterized lipoprotein ycdA;Flags: Precursor; SW:GN Name=ycdA; OrderedLocusNames=BSU02780; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->354|YCDA_BACSU|0.0|100.0|354/354| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| TM:NTM 1 TM:REGION 6->24| SEG 23->40|sgsktsaekkesetekss| BL:PDB:NREP 1 BL:PDB:REP 128->303|2ioqB|1e-04|28.5|165/577| RP:PDB:NREP 1 RP:PDB:REP 45->165|3cfuB|3e-13|18.5|119/131| RP:PFM:NREP 1 RP:PFM:REP 44->142|PF11611|5e-05|34.7|98/120|TRF2| HM:PFM:NREP 1 HM:PFM:REP 40->148|PF11611|5.3e-26|34.3|108/123|TRF2| RP:SCP:NREP 1 RP:SCP:REP 45->141|1xo8A|2e-04|14.4|97/151|b.1.25.1| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1121---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 85.6 SQ:SECSTR ############################################EEETTEEEEEEEEEccccEcccccEEEEE#EEEcccccEEEEGGGEEEEcTTcccccEEcGGGTTcccEEEEcTTcEEEEEEEEccccccccEEEEcHHHHcccTTcHHHHGGGcccEEEEccHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHTTHHHHccHHTTHHHHHHHcccEETTcccccHHHHHTTccTTcccEEEEEcccHHHHHHcHHHHHHHHHcccEEEcccTHHHHTTTccEETTEEEEETTcccHHcccccHHHH#####HHHHHHHcccTTcccccccccGGGHHHHHHHHHH# DISOP:02AL 1-4, 22-43, 112-115, 253-255| PSIPRED cccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccccEEEEEEEEEEccccccccccccEEEEEEEEEEEcccccccEEcccccEEEEcccccccccHHHHHHHHccccccccccccccEEEEEEcccEEEEEEccHHcccccccEEEEEEEcccHHHHHHHHHHHcHHHHEEEEEEEEEEcccccHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccEEEEEEEccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHcc //